KEGG   Bacillus subtilis subsp. subtilis 168: BSU07720
Entry
BSU07720          CDS       T00010                                 

Symbol
yflD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936125
NCBI-ProteinID: NP_388653
Pasteur: BG12939
BSORF: BG12939
UniProt: O34489 A0A6M4JGE1
Position
844097..844234
AA seq 45 aa
MREKVAKNAVESTFRFDITKCKTRYLSRNKGIKWYIENCMIKYKV
NT seq 138 nt   +upstreamnt  +downstreamnt
atgagggagaaagtggcgaaaaacgccgtcgaatcaacgtttcgctttgatattaccaaa
tgtaaaacaaggtatctttctagaaataaaggaataaaatggtacattgagaattgtatg
ataaaatataaggtatag

DBGET integrated database retrieval system