KEGG   Bacillus subtilis subsp. subtilis 168: BSU07735
Entry
BSU07735          CDS       T00010                                 

Symbol
yflB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DJC28_CD
Other DBs
NCBI-GeneID: 936124
NCBI-ProteinID: NP_388655
UniProt: O34887 A0A6M3ZIG0
Position
844253..844645
AA seq 130 aa
MDFSHIVSEDKIKRAIKDGDFQNLPGMGKPLPKDDAAHLPESLRMGYRILKNAGMAEDEG
ALKKELMTIDHLIEKCYDEKEREQLIRKKSEKQLLLDKLVDKKGMFSKPASAFYKNKVYD
RLGRNRPSSS
NT seq 393 nt   +upstreamnt  +downstreamnt
atggatttttcccatattgtgtctgaagataaaattaagcgcgccatcaaagacggggac
tttcaaaacctcccgggaatggggaagccgctgccgaaggatgacgcggcacacttgccg
gaatcgctgcgcatgggctatcgtattttgaaaaacgcgggaatggcagaggacgagggc
gcgctcaaaaaagagcttatgaccatcgaccatttaatcgaaaagtgctatgacgaaaaa
gaacgcgagcaattaatcagaaaaaaatctgaaaagcaattgctgcttgataagcttgtc
gacaaaaaaggcatgttttcaaagccagcatccgctttttataagaataaagtatatgac
cggcttggacgaaacagaccttcttccagctga

DBGET integrated database retrieval system