KEGG   Bacillus subtilis subsp. subtilis 168: BSU07750
Entry
BSU07750          CDS       T00010                                 

Gene name
yflA
Definition
(RefSeq) transporter
  KO
K03310  alanine or glycine:cation symporter, AGCS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU07750 (yflA)
SSDB
Motif
Pfam: Na_Ala_symp
Other DBs
NCBI-GeneID: 939686
NCBI-ProteinID: NP_388656
Pasteur: BG12936
BSORF: BG12936
UniProt: O34708
Position
844770..846185
AA seq 471 aa
MERLLVWIEHISDWLWGPPLIILLTGTGLYFTILLKGFQFRYPLYIFKQTIGSVGKKPKG
EGTVTPLQALTSALSSTIGAANIVGVPAAIMFGGPGAVFWMWLIALFAMAIKFSESVLAV
HYREKNEQGEYVGGPMYYITKGLRMKWLGVFFSVALIVELIPSIMVQGNSVSVSLAETFS
FNKIYAGIGIAFLIGLVVIGGVKRIGKVTEFVVPLMAGAYAGAGLLIVLMNLSSVPAFFS
LVFSNAFTSSSAVGGFAGAALAETVRWGFARGLYSNEAGMGTAPIAHAAAMTDHPVRQGF
WSVIGIVIDTLIICTTTAFIVLASGVWTGKNASNDPAALTTAAFQHYFGSGGGYFVSVSL
VFFVVSTIMVVIFYGVKQAEFLFGRLAGHVIKFVYLAAIIIGAAGGAKAIWGVLDLALVF
IVVPNVIALLLLSRKVKALYTEFFTSEQYYLKDIRKTKQKPVYPTKEAKNS
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggaacgactattagtatggatagagcatatatctgattggctgtggggtccgccgcta
atcatcctgctgacggggacgggcttgtatttcactattttgctgaaaggttttcaattt
cgctatcctttatacattttcaaacagacaatcggcagtgtaggaaaaaagccgaaggga
gaaggcacagtcacaccgcttcaggcattgacctcagccctcagttcaacgatcggtgca
gcgaacattgtcggtgtgcccgccgctattatgtttgggggaccaggagcggttttttgg
atgtggcttattgccttatttgccatggcgattaagttttctgaaagtgttcttgctgtt
cattacagagaaaaaaatgagcagggtgaatacgtcgggggaccgatgtattacataaca
aaagggctgcgcatgaaatggctcggcgtattcttctctgttgcgctgattgtggagctg
attcccagcattatggttcagggaaattcggtttcagtctcgcttgccgagacgttttct
ttcaataaaatatacgcaggaatcggaattgcatttttgattgggttagtggtgatagga
ggggtaaagcggatcggaaaagtaacagagtttgtcgtgcctcttatggcaggggcatac
gcaggtgccggtctcctgattgttctcatgaatctatcatcagtgccggcgtttttctct
ctcgttttttcaaatgcgtttacctcttcttcagcagttggagggttcgcaggtgctgcg
ttggcggaaaccgttcgctggggatttgcccgcgggctgtattctaatgaagccgggatg
ggaacagccccgattgcacatgcggcagcaatgactgatcatcctgtgcggcaagggttt
tggtctgtgatcggcattgtcattgacaccttaatcatctgtacgactaccgcttttatc
gtccttgcatccggtgtatggacagggaagaacgcctcaaatgacccggcagcactgaca
acggccgcatttcagcactatttcggttctggaggaggatacttcgtttcggtttccctg
gtcttctttgtcgtatcaaccattatggttgtcattttttacggcgtaaagcaagctgaa
tttctgttcgggcggctggcaggacatgtgattaaattcgtttatttagcggctattatc
ataggtgccgcaggcggagcaaaagccatttggggcgtattggacttagcattggttttt
attgttgtcccgaatgtgattgcgctcttgttattgagcagaaaggtaaaagcgctgtac
accgaattctttacatctgaacagtactacctgaaagatataagaaaaacgaaacaaaag
cctgtttatccaacaaaagaagctaaaaattcctag

DBGET integrated database retrieval system