KEGG   Bacillus subtilis subsp. subtilis 168: BSU07770
Entry
BSU07770          CDS       T00010                                 

Symbol
yfkS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MASE3
Other DBs
NCBI-GeneID: 936123
NCBI-ProteinID: NP_388658
Pasteur: BG12934
BSORF: BG12934
UniProt: O35036 A0A6M4JL33
Position
complement(847282..847482)
AA seq 66 aa
MISYIVQTLIVCIAIYAYEWKNFRSANNLTKWAFSLLIAGSAFLWIYMRVNPLLPRLGHL
FKYIPF
NT seq 201 nt   +upstreamnt  +downstreamnt
atgatcagctatatcgtacagacattgattgtgtgcattgccatatacgcatatgaatgg
aagaattttcgttccgctaacaatctaacaaaatgggccttcagcctgctaattgcagga
agtgcttttctatggatttatatgagagtgaatcccctgcttccgcggctggggcacctg
tttaaatatattccgttttga

DBGET integrated database retrieval system