KEGG   Bacillus subtilis subsp. subtilis 168: BSU07780
Entry
BSU07780          CDS       T00010                                 

Symbol
yfkR
Name
(RefSeq) spore germination protein YfkR
  KO
K06308  spore germination protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU07780 (yfkR)
SSDB
Motif
Pfam: Spore_GerAC
Other DBs
NCBI-GeneID: 936126
NCBI-ProteinID: NP_388659
Pasteur: BG12933
BSORF: BG12933
UniProt: O35028 A0A6M4JJI9
Position
complement(847498..848652)
AA seq 384 aa
MKKTIYKCVLPLLICILLTGCWDRTEINDIAFVVSSAIDKKKDQYRVAMQIPLVGQLGGQ
TGGGGGTAGSKTWYVDSASGTTIREANNKLQTSLSRTINTSHRRTVIIGEDMARDGVAPV
FDILTRNPQNRLTALILVSRGEARDILNTDVQLEQFPAEMIRELAIIATSRPVFLSRFMS
DLVEIGSDPYAPVISASKTKPGGKGKSNLKIDGLAIFKKDRLMDIFKDEHMTAALMLLNQ
ARQPEFIVDLPNQMGQASIQLQKSNASFHAAEKNGKLSMTIEIRAKGIIMENQSTYETRE
NDQYYIIQKALNRTIKKDVISTVHRLQKLKADPAGFQDRTIRSTATTKNLLKKEWEEVYK
DMEVHVVPIVTIEQGGVLYKTISH
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaagaaaacaatatataagtgtgttttgccgcttctcatttgtatccttctaacgggg
tgctgggaccggacagaaatcaatgacattgcatttgttgtcagctcagccattgataag
aaaaaagatcagtatcgagtggccatgcagattcccttggtcggccaattaggcggacaa
acagggggcggcggcggaactgccggttcaaaaacatggtatgttgattcagcttccggc
actacgatcagagaagcgaacaacaagctgcaaacctccttgtcacggacaatcaatacg
tcccacagacgtacagtcattattggagaggatatggcgagagacggcgttgccccagtc
tttgatattttaacgcgaaatccgcagaacagattaacggcgctcattttagtcagccgg
ggagaagcgcgggacattttaaataccgatgttcagcttgaacagtttccggcggaaatg
attcgggagctggccattatcgcaacgagccgccccgttttcttaagcagattcatgtct
gatctagtagaaataggcagtgatccgtatgcaccggtcatctctgcatctaaaacaaaa
cctggagggaaaggcaaatctaatttgaaaattgacgggcttgcgatctttaaaaaggac
agattgatggatattttcaaagatgaacacatgacagcagccctgatgttgctgaatcaa
gcccgccagccagaattcatagtagacctgccgaatcaaatggggcaagcatccattcag
cttcaaaagtccaatgcatcctttcatgccgctgaaaaaaacggaaagctgtcaatgaca
atcgagatcagagccaaaggaattattatggaaaaccaatcaacctatgagacgagagaa
aatgaccagtattacatcattcaaaaagcattaaacagaaccataaagaaggacgtgatc
agcaccgttcatcgtttgcaaaagctaaaggcggacccggccggctttcaagacaggacc
atcagaagcacggcaaccacgaagaatctgctgaaaaaggaatgggaagaggtatataag
gatatggaggttcacgtcgtcccaattgtgacgattgagcagggcggtgtcctatacaaa
acgatcagccattaa

DBGET integrated database retrieval system