KEGG   Bacillus subtilis subsp. subtilis 168: BSU07800
Entry
BSU07800          CDS       T00010                                 

Symbol
treP
Name
(RefSeq) PTS system-trehalose-specific transporter subunit EIIBC
  KO
K02819  trehalose PTS system EIIBC or EIIBCA component [EC:2.7.1.201]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU07800 (treP)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU07800 (treP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07800 (treP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.201  protein-Npi-phosphohistidine---trehalose phosphotransferase
     BSU07800 (treP)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Trehalose-specific II component
    BSU07800 (treP)
SSDB
Motif
Pfam: PTS_EIIC PTS_EIIB DUF3921
Other DBs
NCBI-GeneID: 939188
NCBI-ProteinID: NP_388661
Pasteur: BG11009
BSORF: BG11009
UniProt: P39794 A0A6M3Z8H7
Position
850367..851779
AA seq 470 aa
MGELNKSARQIVEAVGGAENIAAATHCVTRLRFALIDESKVDQEMLDQIDVVKGSFSTNG
QFQVVIGQGTVNKVYAELVKETGIGESTKDEVKKASEKNMNPLQRAVKTLADIFIPILPA
IVTAGLLMGINNILTAEGIFFSTKSIVQVYPQWADLANMINLIAGTAFTFLPALIGWSAV
KRFGGNPLLGIVLGVMLVHPDLLNAWGYGAAEQSGEIPVWNLFGLEVQKVGYQGQVLPIL
LASYMLAKIEVFLTKRTPEGIQLLVVAPITLLLTGFASFIIIGPITFAIGNVLTSGLISV
FGSFAALGGLLYGGFYSALVITGMHHTFLAVDLQLIGSKLGGTFLWPMLALSNIAQGSAA
LAMMFIVKDEKQKGLSLTSGISAYLGITEPAIFGVNLRYRFPFIIAMVSSGLAGMYISSQ
GVLASSVGVGGVPGIFSIMSQYWGAFAIGMAIVLIVPFAGTYAYARFKHK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgggggaactgaacaaatcggcacgtcagattgtcgaagcagtcggcggtgctgaaaat
attgcagcggcaactcattgtgttacacgtttgcgttttgctttaatagatgaaagcaag
gttgaccaagagatgcttgatcaaattgatgtggtaaagggatcattctcgacaaacgga
cagtttcaggtcgtaatcggccagggaactgtcaataaagtatatgctgaactggttaag
gaaacggggattggcgagtcaacaaaggatgaagtgaagaaggcctcagaaaaaaatatg
aatcctttgcagcgtgctgtgaaaacgcttgcagatatttttattccaatattgcctgcg
attgtcacggcgggtcttttaatggggatcaataacattttaacggcggaaggcattttc
ttcagcacaaaatcgattgtgcaggtttatccgcagtgggcggatcttgctaatatgatt
aacctgattgcaggcacggcctttacgtttttgcctgcgttaatcggatggtctgccgtc
aagcggttcggcggcaatccgcttctcggcattgtgctcggggttatgctcgtgcatcct
gatttgctgaatgcgtggggatatggcgcggcagaacaaagcggagagatcccggtatgg
aatctattcggcctagaggtgcagaaagtcggctatcagggccaggtgctcccaattttg
cttgcttcttatatgctggcgaagattgaggtatttttaacaaaacgcacacctgagggc
atacagctgctcgttgtcgcaccaattacgcttctcttaacaggatttgcctcttttatc
attatcggcccgattacatttgcgatcggtaatgtactgacttcagggcttatctcggtg
tttggttcttttgccgcactgggcggtctgttatatggcggtttctactcagcgctcgtg
attaccggtatgcatcacacgtttcttgcagtcgacctgcagctcatcggttcaaagctc
ggcggcacctttttatggccgatgctggcgctttctaatatcgcacaaggttcggcggct
ctggccatgatgtttatcgtgaaggatgagaaacaaaaaggcctctccctcacatcaggg
atttctgcttatcttggcattacagagcctgccatctttggggtgaatctgcgatacaga
ttcccgtttatcattgcaatggtcagctctggcctggccggaatgtatatttcttctcaa
ggtgtgctggcaagctccgtcggtgtcggcggcgtgccggggattttctcaatcatgagc
cagtactggggcgcgtttgcaatcgggatggctattgtattgatcgtgccgtttgccgga
acatacgcgtatgcgagattcaaacataaataa

DBGET integrated database retrieval system