KEGG   Bacillus subtilis subsp. subtilis 168: BSU07830
Entry
BSU07830          CDS       T00010                                 

Symbol
yfkO
Name
(RefSeq) NAD(P)H nitroreductase YfkO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-GeneID: 939189
NCBI-ProteinID: NP_388664
Pasteur: BG12931
BSORF: BG12931
UniProt: O34475 A0A6M4JGE8
Position
854412..855077
AA seq 221 aa
MADLKTQILDAYNFRHATKEFDPNKKVSDSDFEFILETGRLSPSSLGLEPWKFVVVQNPE
FREKLREYTWGAQKQLPTASHFVLILARTAKDIKYNADYIKRHLKEVKQMPQDVYEGYLS
KTEEFQKNDLHLLESDRTLFDWASKQTYIALGNMMTAAAQIGVDSCPIEGFQYDHIHRIL
EEEGLLENGSFDISVMVAFGYRVRDPRPKTRSAVEDVVKWV
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcagatctaaagacacaaattctggatgcatacaatttcaggcatgcgactaaggaa
tttgacccgaataaaaaagtgtcagacagcgattttgaatttattttagaaacaggaaga
ctgtctccgagctcactcggccttgagccttggaaatttgtcgtcgtccaaaatccggaa
ttccgcgagaagcttcgtgaatacacatggggcgcgcaaaagcagctgccgaccgcaagc
catttcgtcctgattcttgcgcgtacagcgaaggatatcaaatataatgcggactacatc
aaacgtcatttaaaagaagtaaaacaaatgcctcaagacgtgtacgaaggctatttaagc
aaaacagaagaattccagaaaaacgatttgcatttgcttgaaagtgacagaacattgttt
gactgggcatcaaaacaaacctatatcgcgcttggcaacatgatgactgccgctgcgcaa
atcggtgttgattcctgcccgatcgaaggcttccagtacgatcacattcaccgtattctt
gaagaagaaggccttctggaaaacggaagcttcgatatttctgtgatggtggcattcggc
taccgagtgagagaccctcgtccgaaaacaagatctgctgttgaagatgttgtgaagtgg
gtttaa

DBGET integrated database retrieval system