KEGG   Bacillus subtilis subsp. subtilis 168: BSU07850
Entry
BSU07850          CDS       T00010                                 

Symbol
yfkM
Name
(RefSeq) general stress protein 18
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DJ-1_PfpI GATase GATase_3 GATase_5 Peptidase_C26 SNO ThiJ_like
Other DBs
NCBI-GeneID: 938808
NCBI-ProteinID: NP_388666
Pasteur: BG12929
BSORF: BG12929
UniProt: P80876 A0A6M4JHD8
Position
859745..860263
AA seq 172 aa
MGKKIAVVLTYYFEDSEYTEPAKAFKEAGHELTVIEKEKGKTVKGKQGTAEVTVDASIDD
VNSSDFDALLIPGGFSPDQLRADDRFVQFTKAFMTDKKPVFAICHGPQLLINAKALDGRK
ATGYTSIRVDMENAGADVVDKEVVVCQDQLVTSRTPDDIPAFNRESLALLEK
NT seq 519 nt   +upstreamnt  +downstreamnt
atggggaaaaaaattgcagttgttttaacatattattttgaggacagcgagtacactgag
cctgcgaaagcctttaaagaagcgggacatgaactgactgtcatcgaaaaagaaaaagga
aaaacagtaaaaggcaagcagggaacagcggaagtgacggttgacgcgtccattgacgac
gtaaattcttcagactttgatgcgcttttgattcctggaggattttcaccagaccagctt
cgcgctgacgatcgtttcgtccaatttacaaaagcgtttatgactgacaaaaagccggta
tttgccatttgccacggcccgcagcttttaatcaatgcgaaagcgctcgacggccgaaaa
gcgacgggctatacgtccattcgtgttgacatggaaaacgccggtgccgacgttgtggac
aaggaagtggttgtttgccaggatcaattggtcactagccgcacaccggacgatataccg
gcatttaaccgcgagtcattggcattgcttgagaaataa

DBGET integrated database retrieval system