KEGG   Bacillus subtilis subsp. subtilis 168: BSU07860
Entry
BSU07860          CDS       T00010                                 

Symbol
yfkL
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 MFS_4
Other DBs
NCBI-GeneID: 939689
NCBI-ProteinID: NP_388667
Pasteur: BG12928
BSORF: BG12928
UniProt: O34597 A0A6M4JEA9
Position
complement(860303..861493)
AA seq 396 aa
MQTTSIKTASGMYINYFFLGMVNIILASNMSSLTKQWNTDPTGISYVIAAIGFGKLLTYG
ISGVLSDKIGRKPLVVASAGIMAVFLVGIPLSPSYELAFVFALLAGVANSAMDAGTYPAL
TELFPSASGSANVLVKAFMSVGAALLPLLITFLADHSMFYGFAFYLPAAVYLLNIIYLST
LSFPKKHKKPTNSGQQESPVFLSEPVFQKEGTALIIIGFTSTALFTVSQIWLPSYAQKAA
GLAESASVQLLSYYSIGSLASVLLLAVLLNRWVKPVFITLLYPIITLCTLAVMLTVHIPV
VLDITAFFLGFSTAGVFQITITLMTELFWKRKGTVTGIVATASSLASILLPIATGLIAKA
GGIAHIFIFDFGIAVIGTAAAAFLYYRYKKLTGAQA
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgcaaacgacatctatcaaaacagcatccggaatgtatatcaactacttctttctgggg
atggtcaacatcattctcgcatccaatatgtcttcattaacaaaacagtggaataccgat
ccgaccggcatcagttatgtcattgccgctatcgggtttggcaaactgctgacatacggc
atttccggcgttctatcagataaaatcggcagaaagccgcttgttgtcgcttctgcggga
attatggccgtctttttagtcggtattcctttatcaccgagctatgagctggcgtttgtg
ttcgctttattagccggagtcgctaattcagccatggatgccggaacatatccggcccta
accgagctctttccgtctgcttccggttcggcaaatgtcttggttaaagcctttatgtct
gtgggggccgcacttttgccgcttttgatcacatttttagcagaccacagcatgttttac
ggatttgctttttatctgccggcagcggtctatctcctgaatattatttatttatcaacg
ctttcgtttcctaaaaaacataagaaaccaactaatagcggccaacaggaatctcccgtt
ttcttgtctgaacccgtttttcagaaggaaggcaccgcactgattatcatcggttttaca
tccacggctttatttacggtttctcaaatctggctcccgagctacgcgcaaaaggcagcc
ggtttagctgaatcagcatctgtacaattgctgagctattatagtataggatctctggca
tctgttttattattagccgttttgctgaatagatgggtcaaacctgtcttcataacgctc
ttatatcctattattactttatgtacgctcgcagtcatgctgaccgttcatatcccagtt
gtgctggacatcactgcctttttcttaggcttttcaactgcgggtgtgtttcaaattacc
attacgttaatgacagagcttttctggaagcgaaaaggaaccgttaccggaattgtagcg
actgcttcaagtcttgcatcgattctgctgccgattgcaacagggcttatcgcaaaagcg
gggggcatcgcccatattttcatattcgacttcggcattgcggtcatcggaacggctgca
gctgctttcttgtattacaggtacaagaaactgacaggtgctcaagcctaa

DBGET integrated database retrieval system