KEGG   Bacillus subtilis subsp. subtilis 168: BSU07870
Entry
BSU07870          CDS       T00010                                 

Symbol
yfkK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1128 TRPM_tetra Acetyltransf_11
Other DBs
NCBI-GeneID: 936130
NCBI-ProteinID: NP_388668
Pasteur: BG12927
BSORF: BG12927
UniProt: O35019 A0A6M3Z8Y1
Position
complement(861586..861801)
AA seq 71 aa
MSSPNTETLTQMIEEISQKLNMLNVGVIKAEDFSDEKIEDLTYLHRMVMKKESFSPSEMQ
AIAQELASLRK
NT seq 216 nt   +upstreamnt  +downstreamnt
ttgtccagcccaaatacagaaacattaactcaaatgattgaagagatttcccaaaagctg
aacatgctgaacgtcggcgtaatcaaagcggaggatttcagtgatgagaagattgaagac
ctcacgtaccttcacagaatggtgatgaaaaaagaatcattcagcccaagtgaaatgcag
gcgattgctcaagaattagcctcgcttcgtaaataa

DBGET integrated database retrieval system