KEGG   Bacillus subtilis subsp. subtilis 168: BSU07880
Entry
BSU07880          CDS       T00010                                 

Symbol
yfkJ
Name
(RefSeq) low molecular weight protein-tyrosine-phosphatase YfkJ
  KO
K25307  low molecular weight protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU07880 (yfkJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     BSU07880 (yfkJ)
SSDB
Motif
Pfam: LMWPc
Other DBs
NCBI-GeneID: 939191
NCBI-ProteinID: NP_388669
Pasteur: BG12926
BSORF: BG12926
UniProt: O35016 A0A6M4JJJ7
Structure
Position
862004..862474
AA seq 156 aa
MISVLFVCLGNICRSPMAEAIFRDLAAKKGLEGKIKADSAGIGGWHIGNPPHEGTQEILR
REGISFDGMLARQVSEQDLDDFDYIIAMDAENIGSLRSMAGFKNTSHIKRLLDYVEDSDL
ADVPDPYYTGNFEEVCQLIKTGCEQLLASIQKEKQL
NT seq 471 nt   +upstreamnt  +downstreamnt
atgataagcgtgttatttgtttgtttaggtaacatttgccggtctccgatggcggaagcg
atttttagggacctggcagccaaaaaaggattagaggggaaaatcaaggcggactcagcc
ggtattggcggctggcacatcggcaaccccccgcatgagggaacgcaggagatattgcgc
agagaaggaatcagctttgatggcatgctggcgcgtcaagtcagcgaacaggatctggac
gattttgattacatcattgcaatggatgcagaaaatatcggaagtctcagaagcatggcg
ggttttaaaaacacctcgcatatcaaaaggctcttggactatgttgaagattcagatctg
gctgacgtacccgatccttactacacagggaactttgaagaggtctgccaattaatcaaa
acgggctgtgagcagttgcttgcatccattcaaaaagaaaaacaattgtga

DBGET integrated database retrieval system