KEGG   Bacillus subtilis subsp. subtilis 168: BSU07900
Entry
BSU07900          CDS       T00010                                 

Symbol
yfkH
Name
(RefSeq) ribonuclease-like protein YfkH
  KO
K07058  membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU07900 (yfkH)
SSDB
Motif
Pfam: Virul_fac_BrkB DUF3112
Other DBs
NCBI-GeneID: 936134
NCBI-ProteinID: NP_388671
Pasteur: BG12924
BSORF: BG12924
UniProt: O34437 A0A6M3Z8I7
Position
862836..863663
AA seq 275 aa
MSFLKELFSRYTLHEGQSKSAELAYFFLLSLFPFLIFMLTLTAYLPLSTDDVLGVIEQYA
PASAMSLVESITHQTLNNRNGGLLSFGIIAALWSASNGMNAIVRSLNHAYDVEENRSFII
VRLTSIFLTIAMVFTILVALLLPVFGREIGRLASDFVGASDLFLSVWAAIRWGVSPLVLL
IVFSALYVIAPNKKLSLRFVMPGAVFATIGWIIVSTLFSFYVSTFANYSATYGSIGGIIV
LMIWFYLSGILIILGGEINALLHKRKKLPDENPYH
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagttttttgaaagagcttttcagcagatacacccttcatgaaggacaaagtaaatca
gcggagctggcgtatttttttctattgtcactgtttccgtttttgatttttatgctgacg
ctcaccgcgtatcttccgctttctaccgatgatgttttaggagtcatagaacaatatgct
cccgccagtgcgatgtcactcgttgaatccattacccatcaaaccttaaataatcgaaat
ggcggtttgctgtcattcgggattatcgccgcattatggtctgcgtctaatggaatgaat
gcgatcgtccggtcgctgaaccacgcgtatgatgtggaagaaaaccgctcttttatcatt
gttcgtctaacctcgatttttttgacgattgccatggtatttacgattttagtggctttg
cttctgccggtatttggccgggagattggaaggctcgcttctgactttgtcggcgcgtcg
gatctgtttttatccgtctgggccgccattcgctggggtgtcagcccgcttgtgcttttg
attgttttttccgcgctgtatgtgattgcgccgaacaaaaagctgtctctccggtttgtc
atgccgggtgcggtctttgcgactatcggctggatcattgtcagcacattgttttcattt
tacgtcagcacgtttgcgaactatagcgccacttacgggagcatcgggggaatcatcgtt
ctgatgatttggttttacttgagcggcattttaattatcctaggcggagaaatcaacgct
cttttacataaacgtaaaaagcttcctgatgaaaatccctaccattag

DBGET integrated database retrieval system