KEGG   Bacillus subtilis subsp. subtilis 168: BSU07910
Entry
BSU07910          CDS       T00010                                 

Symbol
yfkF
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 MFS_1_like MFS_4 Sugar_tr MFS_3 PUCC PMP22_Claudin
Other DBs
NCBI-GeneID: 939190
NCBI-ProteinID: NP_388672
Pasteur: BG12923
BSORF: BG12923
UniProt: O34929 A0A6M4JG00
Position
complement(863862..865037)
AA seq 391 aa
MSRFHFFILVLLVSISGFSQGMLLPVISIIFETNGESAAINGLHATGLYIGVLLASPFME
APLRKLGFKPLIVMGGSIVILSLFGFIWLQSVWVWFLLRLFIGIGDHMLHFSTQTWVTSM
SSKQNRGRNLSIYGLSFGLGFAAGPFMVPLVKLSPSLPFIVSGCISLFAWLFVFFLQNAY
PETSPHETKSDNSFRRFYQAMLFGWVAFMPTFGYGFLETALNGSFPVYALRLGISVDAVA
IILPAFAIGSIIFQFPLGILSDKYGRRNVLLVILLTGALCFFIAGVFPSPYVIGGCFFIA
GMAVGSTFTLGISYMTDLLPPHLLPAGNLLCGITFSLGSILGPVAGGWYMQTFESANLFY
FITLTLSSVWLALVLGKPKSWSPAETYSSSS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtcacgatttcatttctttatccttgtcttgctcgtttccatttccgggttttcacaa
ggcatgctgctgcctgtcatttcaatcatttttgaaacaaatggagaatccgctgctatc
aacggcctgcacgcgaccgggctgtatatcggtgtgcttttggcttcgccgtttatggaa
gcaccgctcagaaagctcgggttcaagccgctgatcgtcatgggcggaagcattgtcatt
ttaagcttattcggatttatttggcttcagtcagtttgggtctggttcctgcttcgcctg
ttcattggaatcggcgaccacatgcttcacttttctacgcaaacgtgggtgacctccatg
tcatcaaaacaaaatcgcggaagaaacctgtctatttatgggctttcctttggccttggc
tttgccgcaggcccgttcatggtgccgcttgtcaagctgagtccgtcgcttccttttatc
gtgtccggctgcatcagtctgtttgcgtggctttttgttttctttctacaaaatgcatac
ccggaaaccagtcctcatgaaaccaaatcagacaatagtttcaggcgattttatcaggcc
atgctgtttgggtgggttgcctttatgcctacatttggctatggctttctggaaacggcg
ctgaacggaagctttccggtgtacgcgctccgtttggggatatcagtagacgcagtagcg
atcatccttcccgcatttgcgattggaagcattatctttcagtttccgctcggcatcctc
agcgataaatacggcaggcggaatgtgctgctggtgattttactgactggggctctttgc
tttttcatcgccggtgtatttccttcgccctacgtgatcggcggctgcttttttattgca
ggaatggcagtcggatcaacctttacacttggcatcagctatatgacagaccttcttccg
cctcacctcctgccggcgggaaacctgctttgcggcattacattcagtctcggtagcatc
ctcggcccagttgccggcggctggtatatgcagacatttgaaagcgcaaacttgttctac
ttcattactctcacgcttagctctgtgtggctggcccttgtgctgggcaaaccgaaaagc
tggtcaccggctgaaacctattcttcatcttcttaa

DBGET integrated database retrieval system