KEGG   Bacillus subtilis subsp. subtilis 168: BSU07920
Entry
BSU07920          CDS       T00010                                 

Symbol
yfkE
Name
(RefSeq) cation exchanger YfkE
  KO
K07300  Ca2+:H+ antiporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07920 (yfkE)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU07920 (yfkE)
SSDB
Motif
Pfam: Na_Ca_ex
Other DBs
NCBI-GeneID: 939693
NCBI-ProteinID: NP_388673
Pasteur: BG12922
BSORF: BG12922
UniProt: O34840 A0A6M3Z8I9
Structure
Position
865205..866260
AA seq 351 aa
MNRIFFILVAAGVPLSVIGSLMHWPSAVLFAVYCVTIIALASYMGRATESLSIIAGPRIG
GLLNATFGNAVELIISLFALKEGLTGIVLASLTGSVLGNLLLVAGLSFFVGGLKYKRQEF
NIHDARHNSGLLIFAIIVAFVIPEVFSVGMGNASKLNLSIGISIIMILLYVAALYFKLVT
HRGVYQPNNAAQTEEEEEPEWSGKVATIVLFAATIVVAYISENLVHTFHSVAEQFGWSEL
FIGVIIVAIVGNAAEHASAIIMAFKNKMDIAVEIAVGSTLQIAMFVAPVLVICSIFFPTS
MPLVFTLPELVAMVSAVLLMIAISNDGDSNWFEGATLLAAYVIMAIGFFLL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaatcgtatcttttttattttagtggcggccggtgttccgctttctgtgattggcagt
ttgatgcattggccttccgcggttctatttgcagtttattgcgtgacgattatcgcgctt
gcaagctatatggggagggcgacagaatcactgtccatcattgcaggaccgcgtatcggc
ggtttgttgaatgcaaccttcgggaatgcggtggagctgattatttccctttttgcatta
aaagaaggcctgacaggaatcgtgcttgcctctttaaccggttcagtgctggggaacctg
ttgctggtagcgggcctatcgttttttgtcggcggtttaaaatataagcggcaggaattt
aatatccatgatgcccgccataactccgggcttctgatttttgccatcattgtcgccttt
gtgattccggaggtattctctgttggtatgggaaacgccagcaagctcaatttaagcatc
ggcatcagcatcattatgattctgttatatgtggcggcgctgtactttaaacttgtcacg
catcggggcgtttatcagccgaataatgccgctcagactgaagaagaggaagagccagaa
tggtcagggaaggttgcgacgattgtcttgtttgcggcaacgattgtggttgcatacata
tccgaaaacctggtccatacctttcactcggtggctgaacagttcgggtggagcgagctg
tttattggggtcatcatcgtggcgattgtaggaaatgcggcggagcatgcgtcagcgatt
attatggccttcaaaaataaaatggacattgctgttgaaattgcagtaggctctacgctg
cagatcgctatgtttgtcgcaccggttctcgtcatctgttctatcttttttccgacaagc
atgccgcttgtatttacattgcctgagctcgtcgcgatggtatcagcggttctcttgatg
atcgcgatttcgaatgacggggattccaactggtttgaaggggcgacactgcttgctgca
tatgtcattatggcgatcggctttttccttctttaa

DBGET integrated database retrieval system