KEGG   Bacillus subtilis subsp. subtilis 168: BSU07930
Entry
BSU07930          CDS       T00010                                 

Symbol
yfkD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YfkD
Other DBs
NCBI-GeneID: 936138
NCBI-ProteinID: NP_388674
Pasteur: BG12921
BSORF: BG12921
UniProt: O34579 A0A6M3ZBT7
Position
866331..867125
AA seq 264 aa
MMKKLFHSTLIVLLFFSFFGVQPIHAKKQFKVPNSVASISKENTYPNASQDQPMLQPSKL
AKELLDHSEVKIENPHLIKMLNESNISGTPLAVGYRATIFLGKWALGYESNETVANWEYK
KINTNRADNRGGKETAEMHYAQEQQYRVKGGLTAKVPNAEDVKSMMMQKAMKKTNLPLAF
ETVIGAGTKRDQIYKVAPKKIGYLHAYAPAVNEKGKVTYGEVYLVLKGNKRKLVVKNVTS
QGIGAWIPVQDHVTFGFQLSSLPR
NT seq 795 nt   +upstreamnt  +downstreamnt
atgatgaaaaagctatttcattccacacttattgtgttgttattctttagttttttcggc
gttcagcccatccacgcgaaaaagcagtttaaggttcctaattctgtcgcaagcatttca
aaggaaaacacgtatccgaatgcttcacaggatcagccaatgcttcagccgagcaagctg
gcaaaggaattgctcgatcattctgaggtaaagattgaaaatccgcatctcatcaaaatg
ctgaatgaatccaacatatccggcacaccgcttgcagtagggtaccgggcgacaatattt
ctcgggaaatgggcgctcggctatgaatcaaatgaaacagtcgcaaactgggaatataaa
aaaatcaatacaaaccgtgcggataaccgcggcgggaaagaaacggctgaaatgcattat
gcccaggaacagcagtacagagtgaagggcggcttgacagctaaagttccaaatgctgaa
gatgtcaaaagcatgatgatgcaaaaagcaatgaagaaaacgaacctcccgcttgcattt
gagacggtcatcggggctggcacaaaacgggatcagatttataaagtcgctcctaaaaaa
atcggttatctacatgcatatgcaccggctgtgaatgaaaaaggaaaagtgacttacgga
gaagtgtacttagtgctgaaaggaaataaacgaaaactcgtcgtgaaaaatgtcacgtca
cagggaatcggcgcgtggattccggttcaagatcatgtcacgtttggctttcagctttcc
tcactgccaagataa

DBGET integrated database retrieval system