KEGG   Bacillus subtilis subsp. subtilis 168: BSU07940
Entry
BSU07940          CDS       T00010                                 

Symbol
yfkC
Name
(RefSeq) MscS family protein YfkC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MS_channel DUF3810 DUF4395 DUF4271
Other DBs
NCBI-GeneID: 936137
NCBI-ProteinID: NP_388675
Pasteur: BG12920
BSORF: BG12920
UniProt: O35043 A0A6M4JG26
Position
complement(867164..868006)
AA seq 280 aa
MRMKETLTEIFQNKIVDILLVAVILWIGVFIINRLVQLFFKRTDFIEEKKEKTIESLVRS
VTQYTATIGFIFYVISLFVHDFGKILAGAGVAGIVIGFGAQSLIKDVLAGVFLIYERQLH
KGDYVTVNNLFNGTVEEIGLRSLQIREWSGKLLTISNGEVRQIENYNIDFMRITESFLIS
FKEDPDRVYSVLEEACDMLNEELRDSLKRDEFGNPTEPFQIHGITALNKINRGVEFTVKG
MVKDDDYFSASLAVRRVLVRQLYQNNVQMLEEAVRIERTQ
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcggatgaaagaaacacttacggagatttttcaaaataaaatcgtcgatattctcctc
gttgccgttatcctttggatcggtgtctttatcatcaaccggctggtacagctatttttt
aaacggacggactttattgaagaaaaaaaggaaaaaacgattgaaagccttgtccgttct
gtcacccagtatacggcaacaattggttttatcttttacgttatttctttatttgtgcat
gatttcggcaagatattggccggggcgggcgtagcaggtatcgtgatcggttttggcgcc
caatcgctgatcaaagatgtgctggctggtgtattcttaatatatgaacgccagctgcac
aaaggcgattatgtcaccgtcaacaacttgttcaacgggacagtggaggaaatcggcctc
cgctcgctgcaaatccgggaatggagcgggaagctgctcaccatcagcaacggcgaggtc
agacaaatagagaactataatattgattttatgcggattaccgaatcctttcttatcagc
tttaaagaagatccggaccgcgtgtacagcgtgttggaagaggcatgtgacatgctgaat
gaagagcttcgtgattcattgaagcgggatgaattcggcaatccgacagaaccgtttcaa
atccacggcatcaccgcattgaataaaatcaatcgcggcgtcgaatttacggttaaaggc
atggtgaaagatgatgattatttcagtgccagccttgcagtaagacgggttctcgttcgc
cagctctaccaaaacaatgtgcaaatgcttgaggaagcggtccgaatcgagagaacccaa
taa

DBGET integrated database retrieval system