KEGG   Bacillus subtilis subsp. subtilis 168: BSU07955
Entry
BSU07955          CDS       T00010                                 

Symbol
yfkA
Name
(RefSeq) radical SAM protein YfkA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YfkB Radical_SAM Fer4_12 Fer4_14 M20_dimer
Other DBs
NCBI-GeneID: 938812
NCBI-ProteinID: NP_388677
UniProt: O34400 A0A6M3ZDS7
Position
complement(868007..869128)
AA seq 373 aa
MTQNTKLRPITPEFDPWEAYMDVDQYGDMQLTNVEFTTTTLCNMRCEHCAVGYTLQPKDP
NALPIDLLLKRLEEIPRLRSISITGGEPMLSLKSVKEYVVPLLKYAHERGVRTQINSNLT
LDIERYEWIIPYLDVLHISHNWGTVEDFAEIGFAMMDRKPTFEQRARYFEKMIENSRTLV
DAGVMVSAETMLNKRTLPHIEHIHRQITEDMKCQRHEVHPMYPSDFASALESLSLKEMRQ
AIHRLLDIRDENTWMLFGTLPFYACSPDEDDQKLLRRLRAAKNVTVRNDPDGRSRLNVNI
FDGNIIVTDFGDTPPLGNIQTDSLPSAYEKWRETKLAKELSCHCPNVRCLGPNVLVKNSY
YQDTDFTKRQARS
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgacacaaaacacgaagctgcgtccgattacgcccgagtttgacccttgggaagcctat
atggatgttgaccaatacggagacatgcagctgacaaacgttgaattcacaacaacgaca
ctgtgcaatatgagatgcgagcattgtgctgtaggctatacattgcagcctaaagacccg
aatgctctgccaatagatcttctgttaaaacggctggaggaaatcccgcgcctcagatcc
atcagcatcacaggcggagagccgatgctttcgttgaaatcagtaaaagaatatgttgtt
cctttattgaaatatgcccatgaacggggtgtgcggacacaaattaattcaaatctgacc
ctcgacatcgagcggtacgaatggatcattccgtatctcgatgtgctacatatttcacat
aactggggaacagttgaagattttgctgaaatcggctttgccatgatggacagaaaaccg
accttcgaacagcgcgcgcgctattttgaaaaaatgatcgaaaacagccgcacgctcgtg
gatgccggagtaatggtatctgcggaaacgatgctgaacaaacgaacacttccgcatatt
gagcatattcaccgccaaatcacagaagatatgaaatgtcagcgtcacgaggtccaccca
atgtatccaagcgatttcgcaagcgctcttgaatccctcagcctgaaagagatgagacag
gccattcaccgcttgctggatattcgtgatgaaaatacgtggatgctgttcggaacgctg
ccgttttatgcctgcagtccggacgaagacgaccaaaagctgcttcgccggcttcgcgcg
gcgaaaaacgtcacagtgcgaaatgaccctgacggccgatcccgcctgaatgtgaacatt
ttcgacggaaacattatcgtgaccgatttcggtgataccccgccgcttggcaacattcag
acggacagcctcccttccgcctatgaaaagtggagagagaccaagcttgcgaaagaactg
agttgccactgcccgaatgtccggtgcctcggaccgaatgttcttgtcaaaaacagttat
tatcaggatacagacttcacaaaacgtcaagccaggagttag

DBGET integrated database retrieval system