KEGG   Bacillus subtilis subsp. subtilis 168: BSU07980
Entry
BSU07980          CDS       T00010                                 

Symbol
pdaA
Name
(RefSeq) polysaccharide deacetylase PdaA
  KO
K01567  peptidoglycan-N-acetylmuramic acid deacetylase [EC:3.5.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU07980 (pdaA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BSU07980 (pdaA)
SSDB
Motif
Pfam: Polysacc_deac_1 Sulfatase 3H
Other DBs
NCBI-GeneID: 936136
NCBI-ProteinID: NP_388679
Pasteur: BG12915
BSORF: BG12915
UniProt: O34928 A0A6M4JL51
Structure
Position
869559..870350
AA seq 263 aa
MKWMCSICCAAVLLAGGAAQAEAVPNEPINWGFKRSVNHQPPDAGKQLNSLIEKYDAFYL
GNTKEKTIYLTFDNGYENGYTPKVLDVLKKHRVTGTFFVTGHFVKDQPQLIKRMSDEGHI
IGNHSFHHPDLTTKTADQIQDELDSVNEEVYKITGKQDNLYLRPPRGVFSEYVLKETKRL
GYQTVFWSVAFVDWKINNQKGKKYAYDHMIKQAHPGAIYLLHTVSRDNAEALDDAITDLK
KQGYTFKSIDDLMFEKEMRLPSL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaagtggatgtgttcaatatgctgcgccgccgtattgcttgccggaggtgcagcacag
gcggaagcggtgccgaatgagccgattaattggggctttaaacgaagtgtcaatcatcag
ccgccagatgccgggaagcagctgaacagtttaattgaaaaatatgacgcgttttattta
gggaatacaaaggaaaaaacgatttacttaacgtttgataacggatatgaaaatggctat
acgccaaaagtgcttgatgtcttaaaaaaacatcgcgtaacaggaacgttttttgtcacc
gggcatttcgtaaaggaccagcctcagctgatcaaacgaatgtcagatgagggccatatt
atcggcaatcattcctttcaccatccggatttaacgacaaaaacagctgatcagattcag
gatgaacttgattcagtcaacgaagaggtttataaaattacgggaaagcaggacaacctg
tatttgcgtccgccgcgcggcgtgttcagtgagtacgtactgaaagaaacgaaacgcctc
ggctatcaaaccgttttctggtcggtcgcttttgttgattggaaaatcaacaaccaaaag
ggaaagaaatatgcctacgatcatatgatcaagcaggcgcacccgggagccatttacctg
cttcacaccgtatcgagggacaatgcagaagcgctggatgacgcgattacagatctgaaa
aaacagggctacacttttaaaagcattgatgatctgatgtttgagaaagaaatgaggctg
ccgtctttgtaa

DBGET integrated database retrieval system