KEGG   Bacillus subtilis subsp. subtilis 168: BSU07990Help
Entry
BSU07990          CDS       T00010                                 

Gene name
yfjR
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored Shikimate_DH 2-Hacid_dh_C 3HCDH_N IlvN ApbA Sacchrp_dh_NADP NAD_Gly3P_dh_N OCD_Mu_crystall NAD_binding_7 TrkA_N GFO_IDH_MocA DUF732
Motif
Other DBs
NCBI-GeneID: 939198
NCBI-ProteinID: NP_388680
Pasteur: BG12914
BSORF: BG12914
UniProt: O34969
Position
complement(870388..871248)
Genome map
AA seq 286 aa AA seqDB search
MKIAVIGLGNMGQPIARNVLQAGYELTVYNRTKQKTEDLVTEGAQAADTPRLAAKSADIV
ITMLADDDSVSTVTFGEDGLLEGLAENGIHISMSTISVEFSEKLAAAHAEKGQFFLAAPV
LGRPDAAAKAALRIITAGPAEAKQAAKPLLDSLSQQIFDVGEESKTANAAKISINFLLVS
MLEALSESFLMMEKYGLEQKQFLEIASALFGSPVYQNYGTIMAEQKFEPAGFKMSLGLKD
TNLALAAAKRVSANLPLAELAKSHFESGIEKGFGDLDWAALIKCIK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattgctgtcatcggactcggcaatatgggacagcccattgcccgaaatgttctt
caagcaggctacgaattgactgtctataaccggacgaaacaaaagacagaagaccttgtc
acagaaggcgcacaggcagctgatacgccgcggctggcggcaaagtccgctgatattgtc
atcacaatgcttgcagatgatgattctgtcagcaccgtgacattcggagaagacgggctg
cttgaaggattagcagagaacggcatacacatctcgatgagcacaatcagtgttgagttc
tcagaaaagctcgcagcggctcatgcagagaaaggacaattttttctcgccgctcctgtc
cttggcagaccggatgccgcagccaaagccgcgctccgtatcataacagccggaccggcg
gaagcaaagcaagctgccaagcctctgctcgacagcctgagccagcagatatttgacgtc
ggcgaagaaagcaagacggcaaatgcagccaaaatcagcattaatttcttgcttgtgtcc
atgctggaggcgttatctgaatcctttttaatgatggagaaatacggcttagaacaaaaa
caatttttagaaatcgccagcgcgctctttggttctccagtctatcaaaattacggaacc
attatggccgagcagaaatttgagccggccggcttcaaaatgtctttagggctgaaggat
accaacctggcactcgccgccgcaaaacgggtttctgcaaatcttcctcttgccgagctg
gccaagagccattttgaaagcgggattgagaaaggcttcggggatctggactgggccgca
ctgattaaatgtataaaataa

DBGET integrated database retrieval system