KEGG   Bacillus subtilis subsp. subtilis 168: BSU07990
Entry
BSU07990          CDS       T00010                                 

Symbol
yfjR
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 2-Hacid_dh_C Shikimate_DH 3HCDH_N IlvN ApbA Sacchrp_dh_NADP NAD_Gly3P_dh_N NAD_binding_7 TrkA_N OCD_Mu_crystall
Other DBs
NCBI-GeneID: 939198
NCBI-ProteinID: NP_388680
Pasteur: BG12914
BSORF: BG12914
UniProt: O34969 A0A6M4JJK6
Position
complement(870388..871248)
AA seq 286 aa
MKIAVIGLGNMGQPIARNVLQAGYELTVYNRTKQKTEDLVTEGAQAADTPRLAAKSADIV
ITMLADDDSVSTVTFGEDGLLEGLAENGIHISMSTISVEFSEKLAAAHAEKGQFFLAAPV
LGRPDAAAKAALRIITAGPAEAKQAAKPLLDSLSQQIFDVGEESKTANAAKISINFLLVS
MLEALSESFLMMEKYGLEQKQFLEIASALFGSPVYQNYGTIMAEQKFEPAGFKMSLGLKD
TNLALAAAKRVSANLPLAELAKSHFESGIEKGFGDLDWAALIKCIK
NT seq 861 nt   +upstreamnt  +downstreamnt
ttgaaaattgctgtcatcggactcggcaatatgggacagcccattgcccgaaatgttctt
caagcaggctacgaattgactgtctataaccggacgaaacaaaagacagaagaccttgtc
acagaaggcgcacaggcagctgatacgccgcggctggcggcaaagtccgctgatattgtc
atcacaatgcttgcagatgatgattctgtcagcaccgtgacattcggagaagacgggctg
cttgaaggattagcagagaacggcatacacatctcgatgagcacaatcagtgttgagttc
tcagaaaagctcgcagcggctcatgcagagaaaggacaattttttctcgccgctcctgtc
cttggcagaccggatgccgcagccaaagccgcgctccgtatcataacagccggaccggcg
gaagcaaagcaagctgccaagcctctgctcgacagcctgagccagcagatatttgacgtc
ggcgaagaaagcaagacggcaaatgcagccaaaatcagcattaatttcttgcttgtgtcc
atgctggaggcgttatctgaatcctttttaatgatggagaaatacggcttagaacaaaaa
caatttttagaaatcgccagcgcgctctttggttctccagtctatcaaaattacggaacc
attatggccgagcagaaatttgagccggccggcttcaaaatgtctttagggctgaaggat
accaacctggcactcgccgccgcaaaacgggtttctgcaaatcttcctcttgccgagctg
gccaagagccattttgaaagcgggattgagaaaggcttcggggatctggactgggccgca
ctgattaaatgtataaaataa

DBGET integrated database retrieval system