KEGG   Bacillus subtilis subsp. subtilis 168: BSU08000Help
Entry
BSU08000          CDS       T00010                                 

Gene name
yfjQ
Definition
(RefSeq) metal ion transporter YfjQ
  KO
K03284  magnesium transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08000 (yfjQ)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU08000 (yfjQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CorA MIP-T3_C DUF2207
Motif
Other DBs
NCBI-GeneID: 936159
NCBI-ProteinID: NP_388681
Pasteur: BG12913
BSORF: BG12913
UniProt: O31543
Position
complement(871347..872306)
Genome map
AA seq 319 aa AA seqDB search
MINITAITTEHQLLKNIPIERVEQPDIAWYWVDFYGPEDTETALLRDFFHFHPLAIEDCF
QHMQRPKLDHYDGYRFYVIHALNKETLETEEVDIFQGEKFVVTFHLHETPGIAKVRERLY
ASPDILKKGPGHISYMIMDQLVDEYFPLVYKIEDRLNEIEESRPHKTYGTLMNEVFDLRT
DLLHLRRTIIPMRDLLYRILSLDHVKEQRETKAYFSDIYDHLLKLSEIVESNRDMTSDLR
DSYVTLNSNRMNAIMMTLTIVSTIFIPLTFIAGVYGMNFDFMPELHWKYGYFAVLGLMAA
LVIGMLIWFVHKGWFNIFK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacattaccgcaatcacaacagagcatcagctgctgaaaaatataccgatcgaa
cgagtggaacagcctgatattgcatggtactgggttgatttttacggcccggaggatacg
gaaacggcgttattgagagatttttttcattttcacccgcttgccattgaggattgcttc
cagcatatgcagcggccaaagcttgaccattatgacggctatcgtttttacgtgattcat
gcgctgaataaggaaacacttgagacggaggaagtcgatatctttcaaggcgaaaaattt
gtcgtcacctttcatttacacgaaacgcccggtatcgctaaagtccgggagcgtttgtat
gcttcaccggacatattgaaaaaagggcccgggcatatttcttatatgatcatggatcag
cttgttgatgaatattttcctctcgtgtataaaattgaagaccggctgaatgaaattgaa
gaaagccgtccccacaaaacgtatggaacgctgatgaacgaggtgtttgatctcagaaca
gacctattgcatttgagacggacgattatcccgatgcgtgatttgctctaccggatttta
agccttgaccatgtgaaagagcagcgggaaacgaaagcctatttcagcgacatatatgat
catttgttaaagttgtctgaaattgtggaatccaaccgtgacatgacgtccgacttgcgt
gacagctacgtgacgctaaactcaaaccggatgaatgcgattatgatgacactgacgatc
gtatcaaccattttcatcccgctcacctttattgccggtgtatacggtatgaacttcgac
tttatgccggagctgcattggaaatacggatatttcgctgtacttggcctgatggccgcg
cttgtgattggaatgctgatttggtttgtacataaaggatggttcaatatttttaaatga

DBGET integrated database retrieval system