KEGG   Bacillus subtilis subsp. subtilis 168: BSU08020
Entry
BSU08020          CDS       T00010                                 

Symbol
yfjO
Name
(RefSeq) RNA methyltransferase YfjO
  KO
K03215  23S rRNA (uracil1939-C5)-methyltransferase [EC:2.1.1.190]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU08020 (yfjO)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.190  23S rRNA (uracil1939-C5)-methyltransferase
     BSU08020 (yfjO)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU08020 (yfjO)
SSDB
Motif
Pfam: tRNA_U5-meth_tr TRAM Methyltransf_31 MTS Methyltransf_25 Cons_hypoth95 Methyltransf_15 Met_10 Methyltransf_11 Methyltransf_32 PrmA Ubie_methyltran SecD-TM1 UPF0020 TehB Methyltransf_12
Other DBs
NCBI-GeneID: 936146
NCBI-ProteinID: NP_388683
Pasteur: BG12911
BSORF: BG12911
UniProt: O31545 A0A6M3Z8K8
Position
873402..874802
AA seq 466 aa
MNQQKKQAPVELKVGQTFPLTIKRLGINGEGVGYFKKKVVFVPGALPGEEVVVQATKVQP
KFSEGRIKKIRKASEHRVAPPCPVYEQCGGCQLQHLAYSQQLREKRDIVIQSLERHTKFK
VENMEIKETIGMDNPWNYRNKSQFQIGRSQSGSIIAGLYGLDSHDIVPIKDCIVQHPATN
KTTGIVRRILEDFNVSVYNERKRKGDVRTIVTRVGFETGEVQVVLVTAKETLPHKEEIVK
AIQKRLPEVKSIIQNVNGAKTSVIFGEKTKQLAGKTVIQEVLGDVSFELSARAFFQLNPE
QTVKLYDEVKKAAQLTGKEKVVDAYCGVGTIGMWVADGAKEVRGMDVIKESIDDAKKNAK
KHGMANATYVTGTAEHWLPKWTKEGFRPDVVIVDPPRTGCDSTFLDTIKKVKPKRFVYVS
CNPSTLAKDLQTLSKDYRVDYIQPVDMFPQTAHVEAVARLVLKSSN
NT seq 1401 nt   +upstreamnt  +downstreamnt
gtgaaccaacaaaagaaacaggcgcccgtcgaactgaaggtcggacaaacttttccgctg
acgattaagcgtctcggcattaacggagaaggtgttggctattttaagaaaaaagtcgtc
ttcgtgcccggcgcgcttcctggcgaagaagttgttgtgcaggccacaaaggtccagccg
aagttttcggagggccgcattaagaaaatccgcaaggcatctgagcaccgggtggcaccg
ccttgccctgtttatgaacaatgcggcggctgtcagcttcagcaccttgcatacagccag
cagcttcgggaaaaacgtgatatcgtcattcagtctcttgaacgccatacgaagtttaaa
gttgaaaacatggaaatcaaagaaacgattggcatggacaacccgtggaattaccgcaat
aaaagccaattccagatcgggcgctcgcaaagcggcagcatcatcgccggcttatacggc
cttgattctcatgatatcgtgccgattaaagactgtatcgttcagcatccggcaacgaac
aaaacaacaggcatcgtccgccgcattttagaggacttcaatgtgtctgtttataatgaa
agaaaacgaaaaggcgacgttcgcacgatcgtgacgagagtcggctttgaaacaggcgaa
gtgcaggtcgtgcttgtaaccgcaaaagaaacgcttccgcacaaggaagaaatcgtcaaa
gcgattcaaaagcgattgccagaggtcaaatccattattcagaatgtaaacggggcgaaa
acctcagtgatttttggtgagaaaacaaaacagctcgccggaaaaacagtgattcaagaa
gtgctcggcgacgtatcttttgaattgagcgcccgcgctttcttccagctcaatccggaa
cagaccgtcaagctgtatgatgaagtgaaaaaagcggcgcagctgaccggaaaagaaaaa
gtcgttgatgcgtattgcggcgtcggcactatcggcatgtgggttgcggacggagcgaag
gaagtccgcggcatggacgtcatcaaggaatcaattgacgatgctaagaaaaacgccaaa
aaacacggcatggcaaatgccacatacgtaacaggaacagccgagcactggctcccgaaa
tggacgaaagaaggcttccgcccggacgtcgtcattgtagacccgccaagaacgggctgt
gacagcacgttcttggacacgatcaaaaaagtcaaaccgaaacgctttgtctacgtttcc
tgcaatccatccacgcttgcgaaagatttgcagacgctgtcgaaggactatcgcgtggac
tatattcagcctgtcgatatgtttccgcagacggcgcatgttgaagcagtggcgaggctt
gtattaaaatcgtctaactaa

DBGET integrated database retrieval system