KEGG   Bacillus subtilis subsp. subtilis 168: BSU08029
Entry
BSU08029          CDS       T00010                                 

Symbol
yfzA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YfzA Brr6_like_C_C
Other DBs
NCBI-GeneID: 8302973
NCBI-ProteinID: YP_003097694
UniProt: C0H3X6 A0A6M3Z8J9
Position
875428..875694
AA seq 88 aa
MDKVYKRSWFQTFLAFLVSQLYFNFVELTGWGPKYREMNGFPANIVELDFFQTYLSFYDN
PWFNIITVFLGVFTIIQIITGITKDIRN
NT seq 267 nt   +upstreamnt  +downstreamnt
atggataaagtatataaaagaagttggtttcaaacatttttggcatttttagtatctcag
ctttattttaattttgtagaattaacgggatggggtcctaagtatagagaaatgaatgga
ttcccagcaaacatagttgaactagatttctttcaaacatatctttcattctatgataat
ccatggtttaatattattactgttttcttgggagttttcactattatacaaataattaca
gggataacaaaggatattcgaaattaa

DBGET integrated database retrieval system