KEGG   Bacillus subtilis subsp. subtilis 168: BSU08030
Entry
BSU08030          CDS       T00010                                 

Symbol
dusC
Name
(RefSeq) tRNA-dihydrouridine synthase 2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Dus
Other DBs
NCBI-GeneID: 936154
NCBI-ProteinID: NP_388684
Pasteur: BG12910
BSORF: BG12910
UniProt: O31546 A0A6M4JGH1
Position
876426..877403
AA seq 325 aa
MTENFWRELPRPFFVLAPMEDVTDVVFRHVVSEAGRPDVFFTEFTNSESYCHPDGKDSVR
GRLTFTEDEQPIVAHIWGDKPENFRKMSIGMAELGFKGLDINMGCPVPNVAGNGKGSGLI
CRPAVAAELIQAAKAGGLPVSVKTRLGYTDVDEWREWLTHILKQDIANLSIHLRTRAEMS
KVDAHWELIPEIKKLRDEVAPDTLLTINGDIPDRQTGLKLAEQYGVDGIMIGRGIFTNPF
AFEKEPKEHSSKELLDLLRLHLDLHDEYSKEEARPYKPLPRFFKIYLRGFRGASELRNQC
MNTKSTDEVRALLDDFERKYLDGIE
NT seq 978 nt   +upstreamnt  +downstreamnt
atgacagaaaatttctggcgtgaattaccacggccgttttttgtactggcaccaatggaa
gatgtgacagatgttgttttccggcatgtagtaagtgaagcaggcagaccggatgtgttt
tttacagagttcacaaactcagagagctattgccacccggatgggaaggatagcgtgcgc
ggccgtttgacttttacagaggatgaacagccaattgtggcccatatatggggagataag
cctgaaaacttccgtaaaatgagtattggcatggcagagttaggatttaaaggactagat
atcaatatgggctgccctgtgcctaatgtggcggggaatggaaagggaagcggccttatt
tgccgtcctgcagttgcggcagaattaatacaagctgcaaaagcagggggattgcctgta
agcgtgaagacaagacttggatacacggatgtggatgaatggcgcgagtggctgacacac
attttgaaacaggatattgcgaatctttctattcatctgcgtacaagggcagaaatgagc
aaagtagatgcgcattgggagctcatcccagagattaagaaacttcgtgacgaggtggca
ccagatacattgctaacaataaacggggatattcctgaccgtcaaactggcttgaaactt
gctgaacaatacggcgtcgatggaattatgatagggcgcggtatttttacaaatcctttc
gcttttgaaaaggagccgaaagagcatagcagcaaggaattgcttgatctcttaaggctg
catctggatctccatgatgaatattcaaaagaagaagcccgtccatacaagcctcttcct
cgctttttcaagatttatctccgcggattccgaggggcaagtgaattaagaaatcaatgc
atgaacacaaagtcaacagatgaagtgcgtgcattgctcgacgactttgagagaaagtat
cttgatgggatagagtaa

DBGET integrated database retrieval system