KEGG   Bacillus subtilis subsp. subtilis 168: BSU08040
Entry
BSU08040          CDS       T00010                                 

Symbol
yfjM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 939698
NCBI-ProteinID: NP_388685
Pasteur: BG12909
BSORF: BG12909
UniProt: O31547 A0A6M3Z8W4
Position
877599..878051
AA seq 150 aa
MKRLCIIPCGKKKIWDVQPDAGPVRAEDAYLSPFHQACERYAKTFFDEWVILSAKHGFLR
PDDLVSGNYDVTFGTGHPEIMTADELRRQFHEKGFSDIEELVMLGGKKYRSVLNAVIGEH
QHISWPLSSYKGIGYMLQALNRAVEEKHEL
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaacggctatgcatcatcccctgcggcaagaaaaaaatctgggatgtccagcctgat
gccgggccggtaagagcagaggacgcttatctcagcccgtttcatcaggcgtgcgagcgg
tatgcaaaaacatttttcgatgagtgggtgattttgtcggcgaagcacgggttcctccgc
cctgatgatctcgtttcgggaaattacgatgtcacttttggcaccggtcatccggaaatc
atgacagcggacgagctgcgccgtcaatttcacgaaaaaggcttttctgatatcgaagag
ctagtcatgcttggcggaaaaaaatatcgaagcgttctaaacgccgtcatcggagaacac
cagcatatcagctggccgctatcatcatacaaaggcataggctatatgctccaagcgctg
aaccgggctgttgaagaaaagcatgaactgtag

DBGET integrated database retrieval system