KEGG   Bacillus subtilis subsp. subtilis 168: BSU08050
Entry
BSU08050          CDS       T00010                                 

Symbol
yfjL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3139 Fer4_14 Fer4_12
Other DBs
NCBI-GeneID: 939202
NCBI-ProteinID: NP_388686
Pasteur: BG11034
BSORF: BG11034
UniProt: P40773 A0A6M3ZDT7
Position
878081..878770
AA seq 229 aa
MKKLVFGLLAIVLFGCGLYIYHVWFGDPFSKNAAEQKLVSYVKQTYPKKEIKITNGVYNA
KTSEYVFEATSQSHRYPMCTKGFLHPKVTCDGIEEAYTESVAKHVNEEATKAIEADLKKA
VPRFIKADAALSIENGQFTLDTKWNKKLAEKAPMSMTIQLDASGLSKTDAAKMAETVRKT
LNEKGYTYSNGTIDCMQKDGDGGIGYVKYSIDFLSKAAIQSNDAEELGS
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaaaaaacttgtgtttggcttgcttgccattgtgttattcggatgcggactatatatc
tatcatgtatggttcggtgatccattttcgaaaaatgctgcagaacagaagctagtgtct
tatgtgaaacaaacctatcctaagaaagaaatcaagatcacgaatggggtatataacgct
aaaacgtctgaatatgtatttgaagcaacctcccaatctcatcgctacccaatgtgtacg
aagggatttctgcatcctaaagtaacgtgcgatggaattgaagaagcgtataccgaatca
gtagcaaaacatgtaaatgaagaagcaacgaaggcaatcgaagcagatctgaaaaaagcg
gttcctcgatttataaaagctgatgctgctttgagtatcgaaaacggacagttcacgtta
gatacaaaatggaacaaaaagctggctgaaaaagcgcctatgagcatgacgattcagtta
gacgccagcgggttatcaaaaacagatgccgcaaagatggcggaaacggtcagaaaaacg
cttaatgaaaagggatatacatactcaaacggcacgatagactgtatgcagaaggacggg
gacggcggtattggatatgtcaaatattcaattgattttctttcaaaagcagctattcag
tcaaacgatgcagaggaactaggaagttaa

DBGET integrated database retrieval system