KEGG   Bacillus subtilis subsp. subtilis 168: BSU08060
Entry
BSU08060          CDS       T00010                                 

Symbol
acoA
Name
(RefSeq) acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha
  KO
K21416  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha [EC:1.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU08060 (acoA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BSU08060 (acoA)
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N ECH_1
Other DBs
NCBI-GeneID: 936152
NCBI-ProteinID: NP_388687
Pasteur: BG12558
BSORF: BG12558
UniProt: O31404 A0A6M4JEC7
Position
879002..880003
AA seq 333 aa
MKLLKREGLSLTEEKALWMYQKMLEIRGFEDKVHELFAQGVLPGFVHLYAGEEAVAVGVC
AHLHDGDSITSTHRGHGHCIAKGCDLDGMMAEIFGKATGLCKGKGGSMHIADLDKGMLGA
NGIVGGGFTLACGSALTAKYKQTKNVSVCFFGDGANNQGTFHEGLNLAAVWNLPVVFVAE
NNGYGEATPFEYASACDSIADRAAAYNMPGVTVDGKDILAVYQAAEEAIERARNGGGPSL
IECMTYRNYGHFEGDAQTYKTKDERVEHLEEKDAIQGFKNYLLKETDANKLSDIEQRVSE
SIEKAVSFSEDSPYPKDSELLTDVYVSYEKGGM
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaaattgttaaaacgagaaggcttgtcattaactgaggaaaaagcgctgtggatgtac
caaaagatgctggagatcaggggctttgaagacaaagtgcatgaactgttcgcccaggga
gtgcttcccggattcgttcatttatatgccggtgaggaagccgtggctgtaggggtgtgc
gctcatttacatgatggcgacagcattacaagcacccacaggggacatggacattgtatc
gccaaaggctgtgacctggacggcatgatggcggaaattttcgggaaagcgaccggattg
tgcaaaggcaagggcggttctatgcacattgcggatcttgataaaggcatgttaggcgca
aatggaatcgtcgggggcggctttacgctcgcatgcggatcagcgctcacggctaaatat
aaacagactaaaaatgtaagcgtttgctttttcggggacggggcaaataaccaaggtacc
ttccacgaagggctgaatttagcggctgtatggaaccttcctgtcgtatttgttgctgaa
aacaacggctatggcgaagctaccccatttgagtacgcatcagcctgtgattcaatcgcc
gatcgggcggctgcttataacatgccgggggttacagttgacggcaaagatattttagca
gtttaccaggcagccgaggaagcgatagaaagagcaagaaacggcggcggcccgtctttg
attgaatgtatgacctacagaaactacggccatttcgaaggagatgcccaaacctataaa
acgaaggatgaaagagttgagcaccttgaagaaaaagatgccattcaaggttttaaaaac
taccttttaaaagaaacagatgctaataagctgtcagacattgaacagcgtgtcagcgaa
tcgattgaaaaagccgtctcgttcagcgaagacagcccatatccaaaagattcggagctg
ctgacagatgtgtatgtgtcatatgaaaaaggaggaatgtaa

DBGET integrated database retrieval system