KEGG   Bacillus subtilis subsp. subtilis 168: BSU08070
Entry
BSU08070          CDS       T00010                                 

Symbol
acoB
Name
(RefSeq) acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta
  KO
K21417  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta [EC:1.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU08070 (acoB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BSU08070 (acoB)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Other DBs
NCBI-GeneID: 939697
NCBI-ProteinID: NP_388688
Pasteur: BG12559
BSORF: BG12559
UniProt: O34591 A0A6M4JL60
Position
880007..881035
AA seq 342 aa
MARVISMSDAINEAMKLAMRKDENVLLIGEDVAGGAAVDHLQDDEAWGGVLGVTKGLVQE
FGRTRVLDTPISEAGYMGAAMAAASTGLRPIAELMFNDFIGTCFDQVINQGAKFRYMFGG
KAQVPITVRTTYGAGFRAAAQHSQSLYGLFTSIPGLKTVVPSNPYDAKGLLLAAIEDNDP
VFFFEDKTSYNMKGEVPEDYYTIPLGKADIKREGNDVTLFAVGKQVNTALEAAAQLSERG
IEAEVLDPRSLSPLDEDAIFTSLEKTNRLIIIDEANPRCSIATDIAALVADKGFDLLDAP
IKRITAPHTPVPFSPVLEDQYLPTPDKIVSVTLELLGEPALN
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggcgagagtcataagcatgtcagacgcgatcaatgaagcaatgaagcttgcgatgaga
aaagacgaaaatgtgcttttgatcggtgaggatgtcgccgggggagcggcggtcgatcat
ttgcaggatgatgaagcatggggcggtgtattaggggtcacaaagggactcgtacaggaa
ttcgggcgtacaagagtgctggacactccgatttctgaggcaggctatatgggagcggct
atggctgcggcatcaaccggtttgagaccgattgccgagctgatgtttaacgattttatc
ggcacgtgctttgatcaggtgatcaaccaaggggcgaaattccgttatatgttcggcgga
aaagcgcaagtgccgattaccgtccgcaccacatacggagcagggttccgggccgctgcc
cagcattcacaatcgctgtatggccttttcacgagcatccctggactgaagacagttgtt
ccatccaatccgtatgatgccaaaggtcttttgcttgcagcaatagaagataatgatccg
gtgtttttctttgaagacaaaacgtcctacaacatgaagggcgaggtgccggaagattat
tatacaattcccctcggaaaagcggatatcaaacgcgaaggcaatgatgttacgctcttt
gcagtcggcaagcaggtcaatactgcgcttgaagcggctgcacagctttcagagaggggc
atcgaagccgaggtccttgatccccgcagtctgtctcctctggatgaggatgcgattttc
acatcgttagaaaaaacaaaccggctgatcatcattgatgaagccaatccgcgatgcagc
attgccacggatattgctgcgcttgtcgctgacaagggctttgatttgcttgatgcgccg
attaaacggattacagcgccgcatacaccggttccgttttcaccagtgcttgaagatcaa
tatttgccgacaccagataaaattgtcagcgtcacgcttgaattgcttggcgagccggca
ttgaattaa

DBGET integrated database retrieval system