KEGG   Bacillus subtilis subsp. subtilis 168: BSU08080
Entry
BSU08080          CDS       T00010                                 

Symbol
acoC
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00020  Citrate cycle (TCA cycle)
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU08080 (acoC)
   00020 Citrate cycle (TCA cycle)
    BSU08080 (acoC)
   00620 Pyruvate metabolism
    BSU08080 (acoC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BSU08080 (acoC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 Biotin_lipoyl_2 HlyD_D23 PYNP_C GCV_H RnfC_N DUF2118
Other DBs
NCBI-GeneID: 936147
NCBI-ProteinID: NP_388689
Pasteur: BG12560
BSORF: BG12560
UniProt: O31550 A0A6M4JJL7
Position
881049..882245
AA seq 398 aa
MAVKVVMPKLGMAMKQGEVSIWNKKVGDPVEKGESIASIQSEKIEMEIEAPEKGTLIDIK
VKEGEEVPPGTAICYIGDANESVQEEAGAPVAEDNMPQAVQPVKQENKPAASKKDRMKIS
PVARKIAEKAGLDLKQLKGTGPGGRIVKDDVTKALAEQKKDQAKPVSEQKAQEIPVTGMR
KVIAARMQESLANSAQLTITMKADITKLATLQKQLSPTAEERYGTKLTITHFVSRAAVLA
LQAHPVLNSFYQNERIITHPHVHLGMAVALENGLVVPVIRHAEKLSLIELAQSISENAKK
AREGRAGSEELQGSTFSITNLGAFGVEHFTPILNPPETGILGIGASYDTPVYQGEEIVRS
TILPLSLTFDHRACDGAPAAAFLKAMKTYLEEPAALIL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcggtaaaagtagtgatgccaaaattgggaatggccatgaaacaaggggaagtatcg
atatggaataaaaaagtaggcgacccggttgaaaagggagaaagcattgccagcattcaa
tcggagaaaattgaaatggagatcgaagcgcctgaaaaaggaacgctgatcgatatcaaa
gtgaaagagggagaagaggttccgcccggcacagctatctgctatatcggggacgccaat
gagtcggtgcaggaagaggcgggggcgcctgttgctgaagacaatatgccgcaagccgtc
cagcccgtcaaacaagaaaacaaacccgcagcctccaaaaaagatcgaatgaaaatatct
ccagtcgccaggaaaatagcagaaaaagcaggattagacctaaaacaactgaaaggaact
ggaccaggcggacgaatcgtgaaggatgacgtaacaaaggctcttgctgaacagaaaaaa
gatcaagcaaagcctgtttcggagcagaaagcgcaggaaatcccggtgacaggcatgaga
aaggtcatcgctgcccgaatgcaggaaagcctggcaaacagcgcgcagctgacgatcacg
atgaaagctgatatcaccaagcttgccactcttcaaaaacagctttcaccaactgcggaa
gagagatacggcacaaaactgacgatcactcattttgtctcaagagccgccgttctcgct
ctgcaagctcaccctgtgctgaacagcttttatcaaaatgagcgcatcatcacacatccc
catgtgcaccttggtatggctgtagccttggaaaatggcttagtggtgcctgtcatccgc
catgctgaaaagctatcgctgattgaactggctcaatccatctcagaaaatgccaaaaaa
gcacgcgagggacgtgcgggaagcgaagaactgcaaggatctactttctccattacaaac
cttggcgcgtttggagttgagcatttcacaccgatactaaatccgccggaaacaggcatt
ctcggcatcggagcaagctatgacacaccggtgtatcaaggggaggagatcgtcagaagc
acgatcctgccactcagcctgacatttgatcacagagcgtgtgacggcgcccctgccgct
gcattcctgaaggcgatgaaaacatatttggaagaacccgcagcattaattttatag

DBGET integrated database retrieval system