KEGG   Bacillus subtilis subsp. subtilis 168: BSU08090Help
Entry
BSU08090          CDS       T00010                                 

Gene name
acoL
Definition
(RefSeq) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00020  Citrate cycle (TCA cycle)
bsu00260  Glycine, serine and threonine metabolism
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00380  Tryptophan metabolism
bsu00620  Pyruvate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bsu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU08090 (acoL)
   00020 Citrate cycle (TCA cycle)
    BSU08090 (acoL)
   00620 Pyruvate metabolism
    BSU08090 (acoL)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU08090 (acoL)
   00640 Propanoate metabolism
    BSU08090 (acoL)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU08090 (acoL)
   00280 Valine, leucine and isoleucine degradation
    BSU08090 (acoL)
   00310 Lysine degradation
    BSU08090 (acoL)
   00380 Tryptophan metabolism
    BSU08090 (acoL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU08090 (acoL)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BSU08090 (acoL)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BSU08090 (acoL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored HI0933_like NAD_binding_8 DAO FAD_binding_2 3HCDH_N AlaDh_PNT_C UDPG_MGDP_dh_N Trp_halogenase NAD_binding_7 FAD_binding_3 Lycopene_cycl 2-Hacid_dh_C TrkA_N ApbA
Motif
Other DBs
NCBI-GeneID: 939702
NCBI-ProteinID: NP_388690
Pasteur: BG12561
BSORF: BG12561
UniProt: O34324
Position
882266..883642
Genome map
AA seq 458 aa AA seqDB search
MTLAIIGGGPAGYAAAVSAAQQGRNVLLIDKGKLGGTCLNEGCIPTKSLLESANVLDKIK
HADSFGIELPAGAISVDWSKMQSRKQQVVSQLVQGVQYLMKKNQIQVVKGTASFLSERKL
LIEGENGKEIREADQVLIASGSEPIELPFAPFDGEWILDSKDALSLSEIPSSLVIVGGGV
IGCEYAGLFARLGSQVTIIETADRLIPAEDEDIARLFQEKLEEDGVEVHTSSRLGRVDQT
AKTAIWKSGQREFKTKADYVLVAIGRKPRLDGLQLEQAGVDFSPKGIPVNGHMQTNVPHI
YACGDAIGGIQLAHAAFHEGIIAASHASGRDVKINEKHVPRCIYTSPEIACIGMTERQAR
SIYGDVKIGEFSFSANGKALIKQQAEGKVKIMAEPEFGEIVGVSMIGPDVTELIGQAAAI
MNGEMTADMAEHFIAAHPTLSETLHEALLSTIGLAVHA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacattagccattatcggcggcggacctgcaggctatgcggctgcggtttccgcggca
cagcagggcagaaacgtgctgctcattgacaaaggcaagcttggggggacctgcctgaat
gaaggctgcatcccgacaaagtctttgttagaaagcgcaaacgttcttgataaaatcaag
catgccgacagctttggaatcgaacttccggcaggtgcgatatcagtcgattggagtaaa
atgcaaagccgaaaacaacaggttgtcagtcagcttgtccaaggcgttcagtacctaatg
aagaaaaatcaaatacaggttgtaaagggaacagcctcctttctttctgaaagaaagctc
ttgatcgaaggagaaaacggaaaagaaatcagagaggcggaccaagtattgattgcctcc
gggtcagagccaatcgagctgccttttgccccatttgacggcgaatggatcctcgacagc
aaagacgcgctttctctttccgagattccgtcttcactagtcattgtcggcggcggtgtc
atcgggtgtgagtatgcagggctgttcgccagattgggatcgcaggtgaccatcattgaa
acagcggaccggctgatcccggctgaagatgaagatattgcccgtctctttcaggagaaa
cttgaggaagacggtgtcgaagtgcatacttcatccagattagggcgggtggatcaaacg
gccaaaacggcaatatggaaaagcggtcagcgagagtttaaaacgaaggccgattatgtg
ctggtggcgatcggcagaaaaccccgtcttgacggattgcagctggaacaggccggagtt
gatttttctccaaagggcattccggtgaatgggcacatgcagacgaacgtgcctcatatt
tacgcgtgcggagatgctatagggggcattcagctcgcgcatgccgctttccatgagggc
atcatcgctgcttctcatgcttccggaagggatgtcaaaatcaatgagaaacatgtgccg
cgctgcatctatacgtccccggaaatcgcgtgtatcggaatgacagaacgacaggcaaga
agcatatacggggatgtgaagatcggcgaattttcattttccgcaaacggcaaggcgctc
attaaacagcaagcggaaggaaaggtcaaaatcatggctgaaccggaattcggcgaaatc
gtgggtgtctcgatgattggcccggatgtaaccgagctcatcggccaagcggcagcgatc
atgaatggtgagatgacggcagatatggcggagcattttatcgccgcccatccgacttta
tcggaaacattgcatgaggcgctgttaagcacgatcggccttgcggtacatgcataa

DBGET integrated database retrieval system