KEGG   Bacillus subtilis subsp. subtilis 168: BSU08100
Entry
BSU08100          CDS       T00010                                 

Symbol
acoR
Name
(RefSeq) acetoin dehydrogenase operon transcriptional activator AcoR
  KO
K21405  sigma-54 dependent transcriptional regulator, acetoin dehydrogenase operon transcriptional activator AcoR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU08100 (acoR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU08100 (acoR)
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 GAF AAA_5 Mg_chelatase AAA AAA_3 HTH_23 HTH_psq HTH_29 AAA_16 AAA_2 HTH_30 Xre-like-HTH HTH_28 HTH_7 AAA_PrkA
Other DBs
NCBI-GeneID: 936148
NCBI-ProteinID: NP_388691
Pasteur: BG11790
BSORF: BG11790
UniProt: O31551 A0A6M4JE44
Position
883758..885575
AA seq 605 aa
MNSVPNDLQTWKRFVKDGVLDEARLRKRIAESWHRCKKAEVNPYLEKGPKVLQQTELDQQ
SKKHSFFLTTAKPYLEKLLPAIKEMEMMALLIDSDGVVLALDGHPRALYEAKRINFVEGA
CWTETAVGTNAIGTALHISEPVAIQGSEHYSIASHLWNCSAAPIHHEDGSLAGVIDISCP
AAGAHPHMLGIATAIAYAAERELAAKSREKELELISRFGERAASSVPMVLCNTKQHIISA
SMPIRTSMPDWQGRHLYELKERGYSIENAVTIGDGGTCFYLSEQKKKKAFRFNGVIGQSG
RSQAMLMHLERAAATDASVCLSGETGTGKEVAARALHENSERRHGPFVAVNCGAIPSDLI
ESELFGYAEGAFTGAKRNGYKGAFQKANQGTLFLDEIGEISHSMQVALLRVLQERKITPI
GGTKEIPVDIRVIAATHCDLRELAENGKIREDLFYRLHVYPIELPPLRDRTEDIPDLFEY
YKQKNHWPGDLPSDFCNVLKQWKWPGNIRELFNVFERLSIRFPDGRLRDESLPALLEAAG
LPASSAEKKPAAAGVLTFREQIQKDMMIKALESAKGNVSQAAKISGIPRSTFYKRLKKFN
LSAES
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgaattcggtcccaaacgatttgcaaacctggaaacgttttgtgaaagacggtgtgctt
gacgaagcccgattaagaaaacggattgcagagtcatggcatcgctgcaaaaaagctgag
gtcaatccttatttagaaaaaggcccgaaggttttacagcaaacggagctggatcagcag
tcaaaaaaacattcattcttcttgacgaccgcaaagccttacctcgaaaaactgctgcct
gccataaaagaaatggaaatgatggcgctgttaattgattcagacggtgttgttctggca
ttggacggccatccgcgcgcgctctatgaagccaaacgcatcaatttcgtcgaaggggca
tgctggacagaaacggctgtcggaacaaatgcgattggcacggcgctccacatcagcgag
ccggttgcaatacaaggatcagagcattactctatcgcttcccatctttggaactgttca
gctgctccgattcaccatgaggatggcagccttgcgggtgtaattgacatatcatgcccg
gcggcaggcgcgcatcctcatatgcttggtattgccacggcgattgcctatgccgctgaa
cgggaactcgcagctaaaagccgtgagaaagagctggagctgatcagccgttttggggag
agagctgcatccagtgtgccgatggtgctctgtaataccaagcagcacatcatcagtgcg
agcatgccgattcgaacctcaatgccggattggcagggccggcacctgtacgagttgaag
gaacggggctattcaatcgaaaatgctgtcaccataggagatggcggcacttgtttttat
ctttcggaacaaaagaaaaagaaggcgtttcgattcaatggagtgatcgggcaaagcggc
cgatcgcaagcgatgctgatgcaccttgaacgagcagctgcgacggatgcatcggtctgt
ttgtcgggtgaaacgggtacggggaaggaggtcgcggctcgcgcgcttcatgagaacagt
gagagacggcacggtccgtttgttgctgtcaattgcggagcgattccgtctgatttgatt
gaaagcgaactgttcggatatgcagagggcgcttttacgggagcgaaacgaaatggctat
aaaggcgcctttcaaaaagcgaatcaaggcacattatttttagatgaaatcggagaaatt
tcccactcgatgcaggttgcacttttacgggtgcttcaggaacgcaagataacgccaatc
ggcgggacgaaagaaattccggttgatatcagagttattgccgccacacattgtgattta
cgcgagcttgccgaaaacggaaaaatcagagaggacttgttttaccgtcttcatgtctat
ccaattgaactccctccattacgcgatcgcaccgaggatatcccggatctctttgagtac
tacaaacagaagaatcattggccaggcgatcttccttctgatttttgtaatgtgctgaag
caatggaagtggccggggaatatccgcgagctgtttaatgtgtttgaacgtctttctatc
agatttccggacggccggctgagagatgaatcgcttcccgctttactggaagccgctgga
ttgccggccagctctgcagaaaaaaagccggctgctgccggcgtgcttacttttcgtgag
caaatccaaaaggatatgatgatcaaagcgcttgaatctgcaaaaggaaacgtctctcaa
gccgcaaaaatcagcgggatcccccgaagcactttctacaaacgcctgaaaaaattcaac
ttgtccgctgaatcataa

DBGET integrated database retrieval system