KEGG   Bacillus subtilis subsp. subtilis 168: BSU08110
Entry
BSU08110          CDS       T00010                                 

Symbol
sspH
Name
(RefSeq) small acid-soluble spore protein H
  KO
K06425  small acid-soluble spore protein H (minor)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU08110 (sspH)
SSDB
Motif
Pfam: SspH
Other DBs
NCBI-GeneID: 939208
NCBI-ProteinID: NP_388692
Pasteur: BG12917
BSORF: BG12917
UniProt: O31552 A0A6M4JG23
Position
885629..885808
AA seq 59 aa
MNIQRAKEIVESPDMKKVTYNGVPIYIQHVNEETGTARIYPLDEPQEEHEVQLNSLKED
NT seq 180 nt   +upstreamnt  +downstreamnt
atgaatattcaaagggcgaaagaaattgtagaatctcccgacatgaagaaagtaacatat
aacggcgttcctatttacattcagcacgtaaatgaagaaactggaacagcaagaatttat
ccgcttgacgaaccgcaagaggagcatgaagtgcagctgaacagcttaaaagaggattaa

DBGET integrated database retrieval system