KEGG   Bacillus subtilis subsp. subtilis 168: BSU08120
Entry
BSU08120          CDS       T00010                                 

Symbol
yfjF
Name
(RefSeq) hypothetical protein
  KO
K09771  small multidrug resistance family-3 protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08120 (yfjF)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU08120 (yfjF)
SSDB
Motif
Pfam: UPF0060 EamA CcmD
Other DBs
NCBI-GeneID: 939201
NCBI-ProteinID: NP_388693
Pasteur: BG12908
BSORF: BG12908
UniProt: O31553 A0A6M4JGL2
Position
complement(885844..886173)
AA seq 109 aa
MMLITILLFLAAGLAEIGGGYLVWLWLREAKPAGYGIAGALILIVYGILPTFQSFPSFGR
VYAAYGGVFIVLAVLWGWLVDRKTPDLYDWIGAFICLIGVCVILFAPRG
NT seq 330 nt   +upstreamnt  +downstreamnt
atgatgctgattaccattcttttatttctcgcggcagggcttgctgaaattggcggcgga
tatctggtttggctatggctgagagaggcaaagccagctggctacggaatcgccggggcg
ctgatcctcattgtatacggcattcttccgacgtttcagtccttcccatctttcggccgt
gtatacgccgcttatggcggagtattcatcgtgcttgcggtcctgtggggatggcttgtt
gaccggaaaacacctgatctgtatgactggatcggcgcattcatttgtctcatcggtgtc
tgtgttattttatttgcgccgcgcggataa

DBGET integrated database retrieval system