KEGG   Bacillus subtilis subsp. subtilis 168: BSU08130
Entry
BSU08130          CDS       T00010                                 

Symbol
yfjE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5381 MS_channel
Other DBs
NCBI-GeneID: 939699
NCBI-ProteinID: NP_388694
Pasteur: BG12907
BSORF: BG12907
UniProt: O31554
Position
complement(886223..886681)
AA seq 152 aa
MSEALTFESKYALLYLGGGLLAMIYGLITFFMAFPAFTSRGNVIFTIKTGPSGEIFLRKR
SVLFSEVKRLYMGRHQYSLKGIFFEDIIIEKTDGKIVRIPTWNIITNPLFFEAVERYILP
HLNEEAQNNWISQFTEVQRKAYLKEFENHPKL
NT seq 459 nt   +upstreamnt  +downstreamnt
gtgtctgaagccctcacgtttgaatctaaatatgccctgctttatttgggcggcggatta
ctggcgatgatttatggattgatcacattctttatggcttttcctgcgttcacaagccgt
ggaaatgtcattttcaccataaagaccggacctagtggcgaaatcttcttgagaaagcgc
agcgtgctgttttccgaggtgaagcggctttatatgggacgccatcaatacagtttgaaa
gggatcttttttgaggatattatcatcgagaaaacagacggcaaaatcgttcgaatcccg
acctggaacatcatcacgaatccgctgtttttcgaagcggttgaacgctatatccttccc
catttgaatgaagaggctcaaaacaattggatcagccaatttacagaggttcagcgaaaa
gcgtatttgaaggaatttgagaatcatccgaagctttaa

DBGET integrated database retrieval system