KEGG   Bacillus subtilis subsp. subtilis 168: BSU08140
Entry
BSU08140          CDS       T00010                                 

Symbol
yfjD
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5381 PIG-P
Other DBs
NCBI-GeneID: 936158
NCBI-ProteinID: NP_388695
Pasteur: BG12906
BSORF: BG12906
UniProt: O31555 A0A6M4JG42
Position
complement(886775..887332)
AA seq 185 aa
MKNQEIIEVKSKMFLRIWAFVGSAGMGLACLWLFYMGITFQTKYYLLAIPAGFLFTLFCL
YLFIIFFPAFTPRGNTIFRIKTGKNGEVFTDKVSVTFTDIKKIEMSRHKFSLKGIFQEDI
LIQTVDQKTIRIPTWNIIPNPLFFEAVERYILPHLNEEAKSNWIGQFTDIQRSAYLKEFE
NHPKL
NT seq 558 nt   +upstreamnt  +downstreamnt
ttgaaaaaccaagaaatcattgaagtcaaaagcaaaatgttcctgagaatatgggctttt
gtcggatctgccggtatgggattagcatgtttgtggctcttttatatgggtattacgttt
caaacgaaatattacctattagccattcctgctggctttctgttcaccttgttttgttta
tatttatttatcatcttctttccggctttcaccccgcggggaaataccattttccgcatc
aagacaggaaaaaatggagaagtgttcactgacaaagtgtctgttacgtttactgatatc
aagaaaattgagatgagccgccataaatttagtctaaaaggaatcttccaagaagatata
ttgatccaaaccgtggatcagaagaccattcgcattcccacttggaacatcattccgaat
ccgttgtttttcgaagcggttgaacgctatatccttccacatctgaatgaagaggcgaaa
agcaattggatcggacagtttacagacatccaacgcagtgcgtatttgaaggaatttgag
aatcatccgaagctttag

DBGET integrated database retrieval system