KEGG   Bacillus subtilis subsp. subtilis 168: BSU08150
Entry
BSU08150          CDS       T00010                                 

Symbol
yfjC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939231
NCBI-ProteinID: NP_388696
Pasteur: BG12905
BSORF: BG12905
UniProt: O31556 A0A6M4JHG6
Position
complement(887364..888131)
AA seq 255 aa
MKQFTISIEELLFCFYSEGFFEQGMALKQAYFPEIEDEQLGALFEAACRSLLAKDAAEYR
NHQYRLKDEYCPFIHVLNDADYTVKLSKFNGQGAEQNVSCHVSKFGTYSHELLFDEQVHR
ITKMESSEGLLAKTDEFLHIIDTEDKRESIVTLTSNEFEKLLEGASDNPSYLKEFLEKHD
HQEDVTRFANDLALRKGKMDTLMRLAYGKDNTPEVADMAFVLPGAHHTWLVTGITQNEFS
ILPAHKDVVNQIISK
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaagcagtttacaattagcatagaagaactcttgttttgcttttacagcgaagggttt
tttgaacagggaatggccttgaagcaggcctattttccggaaatagaagatgaacagctc
ggcgccttatttgaagccgcgtgccgctcactcttagccaaggatgcagcggaatatcgg
aaccatcaatatcggttaaaggacgagtactgtccgtttatccatgtattaaacgacgct
gactatacagtgaagctttctaaatttaacgggcaaggtgccgaacagaatgtgtcatgc
catgtatcaaaattcggcacctactctcacgaactcctttttgatgaacaagtccatcgc
attacaaaaatggaatcaagtgaagggttacttgctaagacagatgagtttttacatata
atagatacagaggataaaagagaatcgattgtaacattgacatcaaatgaatttgaaaaa
ctcttggagggcgcttcagacaacccttcatatctaaaagagttccttgaaaaacatgac
caccaagaggacgttacccgatttgcaaatgatctggctttgcggaaagggaaaatggat
acacttatgcgtctggcatatggaaaagataacactcctgaagtggctgacatggcattc
gtcctgccgggggcccaccatacttggcttgtcacaggcatcacccagaatgaattttct
atcctccctgctcataaggatgttgtaaatcaaatcatttcaaaatga

DBGET integrated database retrieval system