KEGG   Bacillus subtilis subsp. subtilis 168: BSU08160Help
Entry
BSU08160          CDS       T00010                                 

Gene name
yfjB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4325 Laminin_II Gly-zipper_YMGG TraT DUF3482 EspB
Motif
Other DBs
NCBI-GeneID: 939700
NCBI-ProteinID: NP_388697
Pasteur: BG12904
BSORF: BG12904
UniProt: O31557
Position
complement(888143..889366)
Genome map
AA seq 407 aa AA seqDB search
MSGNIAVDPDKLEQLANDVVTELTDMENKYKDLHVELGQMILQCDPRYSSCFSGVGDAWS
SGKALVTKLSDNEIFIRKTGDKFVEQDDILRKLYNAYDKYGTMTSLTALMLTQGKYYGLG
LTKFVKQPSGLHTAQHSKLLLDISRAVDSSRYQKAARVLLNPKYLLKKTNRPFSDLVHKK
FTKYFPQDTVDFSNSVRSYTKGFLNEAGVRSTLKDVGKTGLRFAKGNAITATLITGATET
FGAGVKIAENYAKYQDKPEVLKRENAKAVGNAVNNTIFVAGGATAGAVIGGAIGSFAGPV
GTVLLGAAGSYIGGVVGEQIAKYTAGFAEKAALKLKEPIHAVVDTAKKGLESAGKVVKSV
NDGIDAANKSIHKGIDSAKKGMEKAKKTADSLIHGATHFLKGKFSFG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaggaaacattgcagttgatccggataagctcgaacagcttgcaaatgatgtagtc
actgaattaactgatatggaaaacaaatataaggacctgcatgtggagctggggcagatg
attttgcaatgcgatccccgctacagcagctgtttttctggagtgggcgatgcgtggagc
tcaggaaaggcgctcgtcactaagctgagtgacaatgagattttcatcagaaaaacaggc
gataaatttgtggaacaagatgatattttgcgaaagctctacaatgcctacgacaaatac
ggtacgatgacaagcttaaccgctcttatgctgacgcagggaaaatattacggattaggg
cttacgaaatttgtgaaacaaccaagcggcttgcatacagcccagcactcaaaactgctc
ttggatatttccagggccgttgacagctcacgttatcaaaaagcggcaagagtgcttttg
aatcctaaatatttgttgaaaaagacaaaccgtccattttcagatttggtacataaaaag
tttacaaaatactttcctcaggacacggtggatttttcaaacagcgtcagaagctacaca
aaaggatttcttaatgaagccggcgtacgctccactttgaaggatgtgggaaaaacgggc
ttgagattcgcgaaaggaaatgccattaccgccacactgattaccggagcgaccgaaaca
ttcggagcaggcgtgaaaattgctgaaaattatgcaaaataccaggataaaccggaagtt
ctcaagcgtgaaaacgccaaggccgtcgggaatgctgtgaataatacgatttttgttgcc
ggcggtgccacagctggtgctgtcatcggcggtgcaatcggaagctttgcaggacctgtg
ggtactgtccttcttggggcagcaggttcatacattggcggagtcgtcggagaacaaatc
gccaaatatacagccggttttgctgaaaaagcagccttaaagctgaaagaaccgatccat
gctgttgttgatacagccaaaaaagggctggaatcagccggcaaagtcgtcaaatcagtg
aatgacggcatagatgcggcgaataaatcgatacataaagggatagacagcgcgaaaaaa
ggaatggaaaaagcaaagaaaacagcggattcgcttatacacggcgcaacccatttcctt
aaagggaaattttcatttggatag

DBGET integrated database retrieval system