KEGG   Bacillus subtilis subsp. subtilis 168: BSU08170
Entry
BSU08170          CDS       T00010                                 

Symbol
yfjA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: WXG100 DUF5082 FTA4 HAUS6_N EzrA AAA_13 Exonuc_VII_L
Other DBs
NCBI-GeneID: 936160
NCBI-ProteinID: NP_388698
Pasteur: BG12903
BSORF: BG12903
UniProt: O31558 A0A6M3Z911
Position
complement(889372..889686)
AA seq 104 aa
MDSYKVIELANKYSAAAEEVRSSKMLLESRLSALGDAWQGKARDSFDQDFEETKAAYDQF
EQELLETSQELKAAAVKIEERKAEIARMEELERKAREERHKLGR
NT seq 315 nt   +upstreamnt  +downstreamnt
ttggactcatataaagtcattgagctggcaaacaagtatagtgcggccgcagaagaggtc
agaagctccaaaatgctgcttgaatcccggttatctgcattgggagatgcttggcagggc
aaagcaagagattcgtttgaccaggatttcgaggaaacgaaagccgcctacgatcaattc
gaacaggagctgcttgaaacaagccaagagctgaaggctgccgctgtcaaaatagaagaa
cgaaaagctgaaattgccagaatggaagaactggagcgtaaagcaagagaggaaagacat
aaactcgggaggtga

DBGET integrated database retrieval system