KEGG   Bacillus subtilis subsp. subtilis 168: BSU08190
Entry
BSU08190          CDS       T00010                                 

Symbol
malR
Name
(RefSeq) RpiR family transcriptional regulator
  KO
K03481  RpiR family transcriptional regulator, glv operon transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU08190 (malR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU08190 (malR)
SSDB
Motif
Pfam: HTH_6 SIS SIS_2 DUF4181 HTH_IclR
Other DBs
NCBI-GeneID: 939205
NCBI-ProteinID: NP_388700
Pasteur: BG11847
BSORF: BG11847
UniProt: P54717 A0A6M3Z8G9
Position
891436..892200
AA seq 254 aa
MQLEELINQHYSKLNDNDFHILKYILNHKHTCYHLGIDALAKACSVSRSSILRLAQKLGF
SGYSEFRVFLKWEDQPEEGESMSFEKLLDDIEANLKFLRTKDMTDMCQLIDAADRIFVYG
SGNAQKICARDLQRMFIPRHRYLILIEDTNEFNLMRDDFKVNDLFIIISLSGETPELIPQ
ARMLSAKGIPFISITNLKNNVLAQLTPHNLYATSKPVTLSDRTEIVAFAPFFLVGEALFR
AYVDYKEAEKNDNE
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcagctcgaagaactgatcaatcagcactacagcaaattgaatgacaacgattttcat
attttaaaatatatattgaatcataagcacacatgctatcaccttggaatcgacgcgctg
gccaaagcttgcagtgtatcgcgttcctcaattttacggcttgcccaaaagctcggtttc
agcggttacagtgaatttcgcgtctttttaaagtgggaagatcagccggaagaaggcgag
agtatgagttttgaaaagctgcttgatgatattgaagcaaatttgaagtttttacggaca
aaggacatgacggacatgtgccagctgattgatgcagctgaccgcattttcgtctacggt
tctggaaatgcgcaaaagatatgcgcccgcgacctgcaaagaatgtttattccgcgccat
cgctatcttattttgattgaagacacaaatgaatttaatttgatgcgcgatgattttaaa
gtgaacgatctgtttatcatcatttctctttccggagaaacaccggagctgattcctcag
gcaagaatgctttctgcaaagggtattccctttatttccattacgaatttaaaaaacaat
gtcctcgcccagctgactccgcataatctttatgcgacaagcaaacctgtgacattaagc
gatagaacggaaattgtcgcttttgcaccgttttttctcgttggcgaagcattgttccgc
gcatatgttgattacaaagaggcagaaaaaaatgacaatgagtag

DBGET integrated database retrieval system