KEGG   Bacillus subtilis subsp. subtilis 168: BSU08220
Entry
BSU08220          CDS       T00010                                 

Symbol
yfiC
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K18888  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU08220 (yfiC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08220 (yfiC)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU08220 (yfiC)
SSDB
Motif
Pfam: ABC_membrane ABC_tran AAA_22 AAA_16 SRP54 SMC_N RsgA_GTPase Zeta_toxin ABC_membrane_2 AAA APS_kinase AAA_25 AAA_30 IstB_IS21 T2SSE EI24 AAA_18 TsaE IncFII_repA AAA_28 MMR_HSR1 Mg_chelatase DEAD AAA_23
Other DBs
NCBI-GeneID: 936167
NCBI-ProteinID: NP_388703
Pasteur: BG11850
BSORF: BG11850
UniProt: P54719 A0A6M4JG29
Position
895619..897433
AA seq 604 aa
MLKDIRKPFQYPKLPIDKKEGAKKRAKAKDTKGTLRRIWSYLAERKGLLILVMLMVVISA
IFGLLGPFVIGKAIDHFIVGKTVSGLIPVLLLLLAIYIIQSLSLWFQNYWMITISQGTVF
RMRSELFTHLHELPIPFFDKQRHGELMSRVTNDIENVSSTLNTSVIQILSSVITFVGTIA
VMLYMSPLLTLITLTIIPVMAASLKWITNRTGKLFKEQQKNLGDLNGYIEESVSGAKVIK
AYSREKQITAEFLEKNAALKTSGFWAQTISGFIPKVMNSLNNLSFTMIAAIGGLFALKGW
ISIGSIVVFAEYSRQFTRPLNDLANQFNTMLSAIAGAERVFDVLDEKEEREDEKNAVHQP
IQTGSIEFRDVSFGYDKGQQTLKHLQFTVPAGQSIAFVGPTGAGKTTVTNLLARFYEPND
GKILIDGTDIKTLTRASLRKNMGFVLQDSFLFQGTIRENIRYGRLDASDQEVEAAAKTAN
AHSFIERLPKGYDTVLTQNGSGISQGQKQLISIARAVLADPVLLILDEATSNIDTVTEVN
IQEALARLMEGRTSVIIAHRLNTIQRADQIVVLKNGEMIEKGSHDELIRQKGFYSDLYES
QFEK
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgctaaaagacatccgcaagcctttccaatatcccaaactgccaattgacaaaaaagaa
ggcgcgaaaaagcgggcgaaagcaaaggatacaaagggcacactgagacgaatctggtct
tacttggctgaaagaaaaggactgctcatacttgtcatgctaatggttgtcatcagcgcc
atattcggactccttggtccctttgtgatcggaaaggccatcgaccattttatcgtcggg
aaaacggtcagcggcttgattcctgttttgcttcttctgctcgctatctatatcattcag
tccctgtcgctttggtttcaaaactattggatgattacgatctcgcagggcacggttttc
agaatgagaagcgaattgttcacccatctgcatgagctgccgattccattttttgataaa
cagcggcacggcgagctgatgagccgggtgacgaatgacatcgaaaatgtcagttctacc
ttaaacacgtcagtcattcaaattttgtcaagtgtgatcacctttgtcgggacgattgcg
gtgatgctgtacatgagcccgctccttactttgattacgctgaccattattccggtgatg
gcagcgagcctgaaatggatcaccaaccgaacgggaaagctgtttaaagaacagcagaaa
aaccttggtgatctgaatgggtatattgaggaatctgtttcaggcgcaaaggtcatcaaa
gcatattcacgtgagaagcagattactgctgaattcctcgaaaaaaacgctgcactcaag
acgtcgggcttttgggcgcagacgatttccgggtttattccgaaggtcatgaactctttg
aataacttaagctttacaatgattgcggcaatcggcggtttgtttgcgctgaaaggctgg
atctcgatcggctccatcgttgtctttgccgagtattcaagacaatttacacgcccttta
aacgatctggccaaccagtttaatacgatgctgtccgcaatcgccggcgctgaacgggtg
tttgacgtgcttgatgaaaaagaagagcgcgaggatgaaaagaacgccgtgcatcagccc
atccaaacaggcagcattgaattccgggatgtgtccttcggttacgataaagggcagcag
acactgaagcatttacagtttaccgtgcctgcggggcagtccatcgcgtttgtaggaccg
acgggggcggggaagacaaccgtcactaaccttctcgcccgtttttacgagcctaacgat
ggaaaaattttaatcgatggtacagatattaaaacccttactagagcaagcctaagaaaa
aacatggggtttgttcttcaggattctttcttatttcagggaacgatcagagaaaacatt
cgctacggcaggcttgatgcttctgatcaggaagtcgaagccgctgcaaaaacagcgaat
gcccatagttttattgaaaggctgccaaaagggtatgacaccgtactgacgcaaaacggt
tcgggcatcagtcaagggcagaagcagttgatttctatagcgagggcggtgcttgccgat
ccggttcttctcattttggatgaagcgacaagcaacattgataccgttacagaagtcaac
attcaagaagcgctcgcccgtttaatggaaggaagaacaagcgtcatcattgcccacagg
ctgaacaccattcaaagagcggaccagattgtggtgctaaaaaacggtgaaatgattgaa
aaaggcagccatgacgagctgattcggcaaaaaggattttacagtgacttatatgaaagc
caatttgagaaatag

DBGET integrated database retrieval system