KEGG   Bacillus subtilis subsp. subtilis 168: BSU08230
Entry
BSU08230          CDS       T00010                                 

Symbol
catD
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DoxX DoxD DoxX_2 ATP-synt_A
Other DBs
NCBI-GeneID: 939204
NCBI-ProteinID: NP_388704
Pasteur: BG11851
BSORF: BG11851
UniProt: P54720 A0A6M4JGM0
Position
897588..897992
AA seq 134 aa
MNKSFEIGTLLLRVITGIIFFVHGLSKFQGMEGTIQFFGSIGLPSFMAYVIAAIELIGGV
LVFFGLATRIVGVLFALTLIGAIITVKLKAPFMGNAEFDYLLLLTSIHLALTGSRFLALD
PFVFKGKKNGNVSA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaataaatcatttgaaattggcacattacttttaagagttattacaggtattatcttt
tttgttcacggtttatcaaagtttcagggaatggagggcaccatccaatttttcggcagc
ataggccttccaagctttatggcgtatgtcatcgcagcgattgaactgattggcggagtg
cttgtcttcttcggattggctacacgtattgtcggtgtactgttcgctcttacactgatc
ggcgccatcatcactgttaagctgaaagcgccattcatgggcaatgcagaatttgattac
cttctgcttttgacatccattcacctggcgcttactggaagtcgattcctggcgctggac
ccatttgtgtttaaaggaaaaaagaacggaaacgtttcagcataa

DBGET integrated database retrieval system