KEGG   Bacillus subtilis subsp. subtilis 168: BSU08240
Entry
BSU08240          CDS       T00010                                 

Symbol
catE
Name
(RefSeq) catechol-2,3-dioxygenase
  KO
K07104  catechol 2,3-dioxygenase [EC:1.13.11.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00361  Chlorocyclohexane and chlorobenzene degradation
bsu00362  Benzoate degradation
bsu00622  Xylene degradation
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU08240 (catE)
   00361 Chlorocyclohexane and chlorobenzene degradation
    BSU08240 (catE)
   00622 Xylene degradation
    BSU08240 (catE)
   00643 Styrene degradation
    BSU08240 (catE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.2  catechol 2,3-dioxygenase
     BSU08240 (catE)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_6 Glyoxalase_4 CppA_N Glyoxalase_3
Other DBs
NCBI-GeneID: 936164
NCBI-ProteinID: NP_388705
Pasteur: BG11852
BSORF: BG11852
UniProt: P54721 A0A6M3Z8Y2
Position
898010..898867
AA seq 285 aa
MTSIHEDTHIGYAKLTIRSLERSLQFYCNVIGFQVLKKTDRQAELTADGKRVLLILEENP
SAVVLPERSVTGLYHFAILLPDRKELGIALARLIEHGIAIGHGDHAVSEALYLSDPDGNG
IEMYADRPRSTWQRDREGNYVMTTTAVDIEGLLEEAGDERKTSLPNDTIIGHIHLHVSDL
KEAKAFYTDVLGFDIVGNYAGMSALFVSAGGYHHHIGLNIWAGRNAPPKPTNASGLDYYT
VVLPHQEELDLVANRVKHAGYSIEETENSFRVKDPVSGAYITFVI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaccagcattcatgaggatacacacattggctatgccaaactcacaattcgcagtctg
gagcgttcgcttcagttctactgtaacgtcatcggttttcaagtcttaaaaaagacggac
cgccaagcggaattaacggctgacgggaaacgcgtactgcttattcttgaagaaaatccg
agcgctgtcgtcttgcctgaacggtctgtgacaggcctttatcactttgcgattcttctt
ccggacaggaaagaacttgggatcgcgctcgcccgcctgattgaacacggcattgctatc
ggacatggagaccatgctgtcagcgaagcgctctacctgtctgatcctgacggaaacggc
attgaaatgtacgctgaccgcccccgcagcacgtggcagcgtgatcgggaaggaaactac
gtcatgacgacaaccgctgttgacattgagggccttctggaagaggcaggagatgagcgg
aaaacatcgcttccgaacgatacaatcatcggacacattcatctgcatgtcagtgatttg
aaagaagcaaaggcgttttatacagatgtactgggctttgacattgtcggaaactatgcg
ggcatgtccgccctcttcgtttcagccggggggtaccaccatcatatcggcttaaacatt
tgggcgggaagaaatgcgccgcctaaaccgacaaatgccagcggactagattattatact
gttgtcctgccccaccaagaggagctggatttggtggcaaaccgagtcaaacatgccggg
tattcgattgaagagacggaaaacagctttcgtgtgaaagaccctgtttccggcgcctat
attacatttgtgatttaa

DBGET integrated database retrieval system