KEGG   Bacillus subtilis subsp. subtilis 168: BSU08250
Entry
BSU08250          CDS       T00010                                 

Symbol
yfiF
Name
(RefSeq) AraC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_AraC AraC_binding HTH_18 Cupin_2 Dimerisation2 Ectoine_synth HTH_23 HTH_31 Dynactin HTH_40
Other DBs
NCBI-GeneID: 939704
NCBI-ProteinID: NP_388706
Pasteur: BG11853
BSORF: BG11853
UniProt: P54722 A0A6M3ZDV2
Position
898961..899905
AA seq 314 aa
MELNHLVTGKIALNQYVHRLEQKDVSFYVHYWGAMTNHYNTLLHKHSFYEICYVVRGEGY
YLEGDRTYPLREQTIFLSKPEHLHQIKSETGLFLFYVAFELSEDQSSAEWIKVMEEVKQS
PFITMQLKDGEPPGLLWKTLMLQAAQPVNAFDKEILSHLSHALILSLIQTFLPYAQRPKQ
KQPIHTSSALLTEVKLHIKDNLSQPLKLTDVASHFHISGRHLSRLFAAELGVSYSEFVQN
EKINKAAELLKSTNLSIKEIAEEIGFSVHYFTRVFSAKIGSSPGLFRSLYKDSKMTAFQI
NKPFQKIEQAKPHE
NT seq 945 nt   +upstreamnt  +downstreamnt
atggaactcaaccaccttgtgacgggcaaaatagcattaaatcaatatgtgcatcgctta
gagcaaaaggatgtttcattttacgtccactactggggagcgatgacgaaccactataac
acactgcttcataagcattccttttatgaaatttgttacgtggtaagaggtgaaggatat
taccttgaaggcgatcgtacatatccgcttcgtgaacagacgatttttttgtcaaagccg
gagcatttgcaccaaatcaaaagtgaaacagggctgttccttttttacgtcgctttcgag
ctgagcgaggatcagtcaagcgccgaatggatcaaagtgatggaagaagtgaaacaaagc
ccctttatcacaatgcaattgaaagatggcgaaccgccgggcctgctttggaaaacgtta
atgctgcaagcagcgcaacctgtcaatgcttttgacaaagagatcctatctcatttgtcg
catgcattgatcctgtcattaatccaaacctttctcccgtacgcccaacgcccgaaacaa
aagcagcccattcacacatcttctgctttgctgacagaggtgaaactgcacataaaagac
aatctgtcacagccgttaaagctgacggatgtcgctagccactttcatatctcagggagg
catttatcacgtttatttgcagcagaactgggcgtcagctactcagaatttgtccaaaat
gaaaaaataaacaaagctgccgaactgctgaaatcaacgaatttgtcgattaaagaaata
gcggaagaaatcggtttctcagtacattatttcactcgcgtcttttccgctaaaatcggc
agctctccagggcttttccgctccctttataaagactcaaaaatgaccgcatttcaaatc
aataaaccttttcaaaaaatcgaacaggccaagccgcacgaataa

DBGET integrated database retrieval system