KEGG   Bacillus subtilis subsp. subtilis 168: BSU08260
Entry
BSU08260          CDS       T00010                                 

Symbol
yfiG
Name
(RefSeq) metabolite transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 DUF6057
Other DBs
NCBI-GeneID: 939710
NCBI-ProteinID: NP_388707
Pasteur: BG11854
BSORF: BG11854
UniProt: P54723 A0A6M4JHI3
Position
900080..901528
AA seq 482 aa
MSTKKKEAVIGKESLAHKGLLRTITLVSTFGGLLFGYDTGVINGALPFMATAGQLNLTPV
TEGLVASSLLLGAAFGAMFGGRLSDRHGRRKTILYLALLFIAATLGCTFSPNASVMIAFR
FLLGLAVGCASVTVPTFLAEISPAERRGRIVTQNELMIVIGQLLAYTFNAIIGSTMGESA
NVWRYMLVIATLPAVVLWFGMLIVPESPRWLAAKGRMGDALRVLRQIREDSQAQQEIKEI
KHAIEGTAKKAGFHDFQEPWIRRILFIGIGIAIVQQITGVNSIMYYGTEILREAGFQTEA
ALIGNIANGVISVIAVIFGIWLLGKVRRRPMLIIGQIGTMTALLLIGILSIVLEGTPALP
YVVLSLTILFLAFQQTAISTVTWLMLSEIFPMHVRGLGMGISTFCLWTANFLIGFTFPIL
LNHIGMSATFFIFVAMNILAILFVKKYVPETKGRSLEQLEHSFRQYGRRADQEIQNQTTH
LS
NT seq 1449 nt   +upstreamnt  +downstreamnt
gtgagtacaaaaaagaaagaggctgtaataggaaaagaaagcttagctcataaagggctt
ttacgaacgattacattggtatctacattcggcggcctgttgttcggttatgatacgggt
gtcattaatggggcacttccttttatggcaactgcaggtcagctgaatcttacacctgtt
acagaaggactggttgcgagttccctgcttctcggggcagccttcggggcgatgtttgga
ggacgtctgtccgatcggcacggccgccgaaaaacgatcctttatttagccttactcttc
atcgcagccacacttggctgtaccttttcaccaaacgcgtccgtgatgattgcctttcgt
tttctgcttggactggcggttggctgcgcttctgtaacggttccaacctttttagcggaa
atttcgccggcagaacgcaggggacgaatcgtgacacaaaatgaactgatgatcgtaatt
ggccagcttctggcatacacctttaacgccattattggcagcacaatgggggagagcgca
aatgtatggcggtatatgctggtcatcgcgacacttccggctgttgtgttatggttcgga
atgctcatcgtgcctgaaagcccgcgctggctggcagctaaaggcagaatgggtgacgcc
ctgcgggtgcttcggcaaatccgtgaagacagtcaggcacagcaggaaataaaagaaatc
aaacatgcgattgagggcacagcaaaaaaggccggctttcatgattttcaagagccgtgg
ataaggcgcattctattcattgggattggaatcgccatcgtacagcaaattaccggtgtc
aattcgattatgtactatgggacagaaattctgagagaagccggttttcaaacagaagct
gcattaatcggcaatattgcaaacggtgttatttcagttattgcggtcatttttgggata
tggcttctcggcaaagtccgtcgccggcccatgctgatcatcggacagattggcacgatg
acagcccttctgctgatcgggattttatccattgtccttgaaggaacacccgccctgccg
tatgttgtgctgagtttgaccattttgtttcttgcgtttcagcagactgccatttctacg
gtgacgtggctgatgctctcggaaatctttcctatgcatgtgcgggggcttggcatgggg
atcagcaccttctgcttgtggacagctaactttctcattggattcacctttcccattttg
ctcaatcatattgggatgtcggcgacattttttatctttgtcgctatgaatatcctagcg
attctatttgtgaaaaaatatgtgcctgagacaaaagggcggtcacttgaacagcttgag
cattcctttcgccagtatggccgccgcgctgatcaggaaatccaaaatcaaacaactcac
ttatcgtaa

DBGET integrated database retrieval system