KEGG   Bacillus subtilis subsp. subtilis 168: BSU08270
Entry
BSU08270          CDS       T00010                                 

Symbol
yfiH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AP_endonuc_2 NAD_binding_10
Other DBs
NCBI-GeneID: 939706
NCBI-ProteinID: NP_388708
Pasteur: BG11855
BSORF: BG11855
UniProt: P54724 A0A6M3Z921
Position
901555..902496
AA seq 313 aa
MKLSYVTDSLGHLPFEDMLNFAAKLGIDTLEMTTGGWSPAPHLNLDELLQSSEKRKEFSQ
ALEKRNMTLCALNCSGNPLDPGELGKSHRDITDKTMELAGLLGVKKVIMMSGLPAGGPDD
KVPNWITYTVSWPPVLKDILNYQWEDVAIPYWKKLVKKAEACGVGKIALENFSSQLVYNP
ETLFRLRNAVGPMVGLNLDPSHLLWMGADPIIAARELGSAIHHVHGKDVRIERYLSAVNG
LLETKEVTDPANRAWNYVAVGCGQDLQWWKEFFSVVKMMGYEGEVSLEMEDLTMSPEAGI
RTSVEALKQTISQ
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaactatcttatgtaacagacagcctagggcatttgccttttgaagacatgctcaat
tttgccgcaaagcttgggatcgatacacttgaaatgacaaccgggggctggtcgccggca
cctcacttgaatcttgatgaattgctgcaaagcagcgaaaaaagaaaagaattttcacaa
gcgctggaaaagcggaacatgacactttgcgcattaaactgctcggggaaccctttagat
ccgggtgaattgggcaaatcgcacagagacataactgacaaaacgatggagctggctgga
ttattaggcgtcaaaaaagtgatcatgatgagcggtttgccagccggcggcccggacgac
aaagtgccgaactggatcacatacacagtaagctggcctcccgttttaaaagatatcctc
aactatcaatgggaagacgttgcgatcccatattggaagaagcttgtcaaaaaagcggag
gcctgcggcgtggggaaaatagcgcttgagaacttcagctctcaattagtctataatcct
gagactctctttcggctcagaaatgcagtcggcccgatggtcggtttgaatcttgacccg
agccatttgttatggatgggcgcagacccgatcatcgcagcaagggagctcggctcagcc
attcaccatgtccatgggaaagatgtcagaattgaaagatatttatcggcggtcaacgga
cttttagaaacaaaagaagtgacagatcctgcaaaccgggcgtggaattacgtagctgtc
ggctgtggacaggatttacagtggtggaaggaatttttttcagttgtaaaaatgatggga
tatgaaggtgaggtttctttagaaatggaggatctgacgatgtcacctgaagcgggcatc
cgtacttctgtagaagctttaaaacaaaccatcagccaatag

DBGET integrated database retrieval system