KEGG   Bacillus subtilis subsp. subtilis 168: BSU08280
Entry
BSU08280          CDS       T00010                                 

Symbol
yfiI
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GFO_IDH_MocA_C GFO_IDH_MocA Sacchrp_dh_NADP Semialdhyde_dh
Other DBs
NCBI-GeneID: 936177
NCBI-ProteinID: NP_388709
Pasteur: BG12214
BSORF: BG12214
UniProt: P94437 A0A6M4JL76
Position
902506..903687
AA seq 393 aa
MMLNGERIISKPLRWAMVGGGRLSQVGYKHRIGALRDNTAFQLTAGAFDIDAERGKDFGV
NLGVDAERCYPNYQTMFAEEAKRQDGIEVVSIATPNGTHYEICKAALEAGVHVICEKPLF
FTSAEGQEIKALAEKKGKIVGVTYGFSGNQMLLQMRAMIEQGMIGDIRVVDLQYTHGFCA
TDEGEKISAAQKWRVDPAIAGPSFVLGDLSTHTYYMSQLIMPKMKIKELLCDRQSFVGSR
APLEDNAHVLMHYENGAVGTMWTSSINAGCMDGHRIRIVGSKASIEWWDSKPNELTYEVQ
GEPGQTLVRGMPYLDDVCNADERLGALHSEGLSEAWANIYLKFAIAIDAKNREDEEILNN
LVYPDIDAGIEGIRWIENCVRSANQGSVWVEFK
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgatgctaaatggagaaagaatcatctctaagccgcttcgctgggcaatggtaggcggc
gggcggctcagccaggttggatataaacatcgtattggagcgctgagagacaatactgct
tttcaattaactgctggcgcttttgatatcgatgccgaaagaggaaaagatttcggggtg
aaccttggagtggatgcggaacgctgttatcccaactatcaaaccatgtttgccgaggaa
gcgaaaagacaggatggcatagaggtagtatcgattgccactccgaacggcactcattat
gagatttgtaaggcggcgcttgaagcaggagtgcatgtcatctgtgaaaaaccgctgttc
ttcacttcagcagaggggcaggaaatcaaagcgctcgcagagaaaaaagggaaaattgtc
ggcgtgacgtacggtttttcaggcaatcaaatgcttcttcaaatgcgtgcgatgattgaa
caaggaatgatcggcgatattcgcgtggttgacttgcagtacacacacggtttttgtgca
acagatgaaggtgaaaagataagcgctgcacagaaatggcgtgtcgaccctgcgatcgcc
gggccaagctttgtgctgggcgatttatctacccacacgtattatatgtcacagcttatt
atgccaaagatgaaaattaaggagctgctgtgtgaccgacagagcttcgtcggcagccgc
gcaccgctagaggataatgcccatgtgctgatgcattatgaaaatggagcggtcggaacg
atgtggacatcgtcaatcaatgccggatgtatggatggccatagaatccggattgtcggc
tcaaaggcaagcattgagtggtgggacagcaagccaaatgaactgacgtatgaagtgcag
ggagagccgggccagacactcgttcgcggcatgccgtatttagatgatgtttgcaacgcc
gatgaacgactgggcgccttacacagcgaagggctgtccgaagcatgggccaatatttat
cttaaatttgccattgcgatagacgccaaaaaccgtgaagatgaagaaatcttgaacaac
ttggtttatcctgacattgatgcagggatcgagggcattcgctggattgagaactgcgtg
cgctcggcaaaccaagggtcagtttgggttgaatttaaataa

DBGET integrated database retrieval system