KEGG   Bacillus subtilis subsp. subtilis 168: BSU08290
Entry
BSU08290          CDS       T00010                                 

Symbol
yfiJ
Name
(RefSeq) sensor histidine kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HisKA_3 HATPase_c ArsP_1 HATPase_c_2 HBM
Other DBs
NCBI-GeneID: 936171
NCBI-ProteinID: NP_388710
Pasteur: BG12215
BSORF: BG12215
UniProt: P94438 A0A6M3Z8H8
Position
903811..905013
AA seq 400 aa
MKALFFTRMFTLMVSCLMYLSIVKEDNWFGYVFIAAGAAMYAANHVLLTKETNAIWFCLI
DIAIGFSFGFIFPGTGLFIIMLCPVAVAFFLRGFPKRTAWSVLCLSSILFLTVLIRTYAM
FGNEFVIDHLTSMTFVVFCGVVGKLIRKLLDAQDTAKQQFQELTESHLALSAAHQELHLY
AKQVEELTAIYERNRMAREIHDTVGHKMTALLVQLQLLREWQKRDSQKADETVGVCETLA
REALDDVRLSVRTLQTENDPSLIESLKQLTEDFCKNAGVTTEFAVSGDPAIIPLSLHPTL
IRTVQEALTNAKRHGGAAACSIQLACTTDSISLVIKDDGKGNPEAALGFGLLNMKKRAAE
HGGMIRFESERDQGFTVNAEFSLANKKWSFGPVQQKESLS
NT seq 1203 nt   +upstreamnt  +downstreamnt
gtgaaagctcttttttttacgagaatgttcaccttgatggtgagctgtttaatgtatctg
tccattgtgaaagaggataactggtttggatatgtatttatagcagcaggtgctgccatg
tatgcagccaatcatgttttgctgacaaaagagacaaatgccatctggttctgcctgatt
gatattgcaatcggcttttcgttcggatttatctttcccggcacaggtttgttcattatt
atgctttgtccggttgcggtcgccttttttctgcgggggtttcctaaaagaacagcatgg
tctgtcttatgtctttcctctattttatttttgaccgtcctcatccgtacatatgcgatg
ttcggcaatgaatttgtcattgatcatttgactagcatgacattcgttgtcttctgcggt
gtcgtgggcaaattaatccgcaagctgttggatgcgcaggatacggcaaaacagcagttt
caggaactgacggagtcccatctggcgctgtctgctgcacatcaggagctccatttatat
gcgaagcaggttgaagagctgactgccatttacgagcggaacagaatggcgcgtgaaatc
catgatacagtggggcataaaatgacggcccttctcgtccagctgcagcttttgcgtgaa
tggcaaaaaagagacagccaaaaagcggatgagacagtaggtgtctgtgaaacacttgcc
cgtgaagcgcttgatgatgtccgcttatcagtacgcactctgcaaactgaaaacgatcct
tcgctaatcgaatcgctgaaacagctgacagaggacttttgcaaaaatgcaggagtcaca
acagaatttgcggtcagcggtgatcctgcaatcatcccgctgtctctccatccgaccctg
atcagaacggtgcaggaagcactgaccaatgccaaacggcacggcggcgccgcagcctgt
tcgatacagcttgcctgcacaacggacagcatcagccttgtcattaaggatgacggcaaa
ggcaatcctgaggcagcacttggttttggtctcttgaatatgaaaaagcgggcagcggag
catggcggaatgatccgctttgaaagcgaacgggatcaaggatttactgtaaatgcagaa
ttttcacttgccaataaaaaatggagcttcgggcccgtgcagcaaaaggagagtttatca
tga

DBGET integrated database retrieval system