KEGG   Bacillus subtilis subsp. subtilis 168: BSU08300Help
Entry
BSU08300          CDS       T00010                                 

Gene name
yfiK
Definition
(RefSeq) transcriptional regulator
  KO
K02479  two-component system, NarL family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU08300 (yfiK)
Two-component system [BR:bsu02022]
 NarL family
  Unclassified
   BSU08300 (yfiK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_24 HTH_10 HTH_40 HTH_11 STAT_alpha HTH_38
Motif
Other DBs
NCBI-GeneID: 939209
NCBI-ProteinID: NP_388711
Pasteur: BG12216
BSORF: BG12216
UniProt: P94439
Position
905010..905672
Genome map
AA seq 220 aa AA seqDB search
MIKIIITDDQDIVREGLASLLQLREELDVIATARNGQEAFEKAKELEPDIVLMDIRMPVS
NGVEGTKLITSSLPSVKVLMLTTFKDSALIAEALEEGASGYLLKDMSADTIVKAVMTVHS
GGMVLPPELTAQMLNEWKREKQLKGINEIEKPNELLDLTEREIEVLAELGYGLNNKEIAE
KLYITEGTVKNHVSNIISKLAVRDRTQAAIYSVRYGVSVF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgattaagatcatcattaccgacgatcaggatatcgtcagagaagggctggcatccctg
ctccagctccgagaagagctcgatgtgatcgcaacggcgcgaaacggacaggaagccttc
gaaaaggcgaaagagctggagccggatatcgtgttaatggacatccgcatgccggtttcc
aacggggtggagggaacaaaattaatcacaagctcgctgccaagcgtaaaggttttgatg
ctgacaacctttaaggattcagcgctgattgctgaagcgcttgaagagggagcaagcggg
tatctgctgaaggatatgtctgcagatacgattgtaaaagcagtgatgactgttcattct
ggcggaatggtgcttccgccggaattgactgcccaaatgctgaatgaatggaagcgtgaa
aaacagctgaaaggaataaatgagatagaaaaacctaacgagctgctcgacctgaccgag
cgcgaaatcgaagttctggctgagctgggatacgggctgaataacaaagaaattgccgaa
aagctttacattacagaaggcacagtcaaaaaccacgtttcaaatattatcagcaagctg
gctgtcagggacagaacccaagccgccatttactcggtcagatatggtgtatctgtcttt
tga

DBGET integrated database retrieval system