KEGG   Bacillus subtilis subsp. subtilis 168: BSU08310
Entry
BSU08310          CDS       T00010                                 

Symbol
yfiL
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K25144  linearmycin/streptolysin S transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08310 (yfiL)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Linearmycin/streptolysin S transporer
    BSU08310 (yfiL)
SSDB
Motif
Pfam: ABC_tran AAA_21 KdpD DUF4162 AAA_29 AAA_30 AAA_27 AAA_23
Other DBs
NCBI-GeneID: 936175
NCBI-ProteinID: NP_388712
Pasteur: BG12217
BSORF: BG12217
UniProt: P94440 A0A6M3Z8N2
Position
905816..906751
AA seq 311 aa
MLQAENIKKAYGKKTIVKGISFSLKKGESFGLLGPNGAGKSTTISMISGLVPHDSGNITV
GGYVIGKETAKAKQKIGIVPQEIALYPTLTAHENLMFWGKMYGLTHGEAKKRAAEVLEYV
GLTERAKDKIETFSGGMKRRINIGAALMHKPELLIMDEPTVGIDPQSRNHILETVKQLNE
TGMTVIYTSHYMEEVEFLCDRIGIIDQGEMIAIGTKTDLCSRLGGDTIIQLTVSGINEAF
LVAIRSLAHVNDVTVHELELKIDISAAHHEKVVTSLLAEATAHHINLLSLQVQEPNLERL
FLNLTGRTLRD
NT seq 936 nt   +upstreamnt  +downstreamnt
gtgctgcaagcagaaaacatcaaaaaggcatacggaaaaaaaacaatcgtgaaaggcatt
tctttttccctcaaaaagggggagtcgttcggtctgctcgggcctaacggtgcggggaaa
tccacaaccatctcgatgatttccggccttgtgccgcatgacagcgggaacatcacggtg
ggcggctatgttatcggaaaagaaacggccaaagcgaaacaaaaaatcggcattgttccg
caggaaattgcattatatccgacgctgacggctcatgagaatcttatgttttgggggaaa
atgtacggacttacgcacggtgaggccaaaaaaagagcggctgaggtccttgaatatgtc
ggtctgactgagcgggctaaagataagattgaaacattttccggggggatgaaacgaaga
atcaacatcggtgcggctttaatgcataagcccgagctgctgattatggatgaaccgact
gtcggtattgaccctcaatcgagaaatcacattttagaaacggtcaaacagctcaacgaa
acgggcatgacggtgatctatacgagtcattacatggaagaagttgagtttttatgcgac
cggatcgggataattgatcagggggaaatgattgcgattggcacaaaaactgatttgtgc
agccgccttgggggcgataccatcattcagctcacggtcagcgggatcaatgaagcgttt
cttgtggcgatccgatctctggcccatgtgaatgatgtaacagtacatgaattagagctc
aaaattgacatttctgcggctcatcatgagaaagtcgtcacaagcctgcttgctgaagcc
actgctcatcatataaacctgctgtctcttcaggtgcaggaaccgaatctggagcgcctg
tttctgaatctgaccggccgcacgttgcgggattga

DBGET integrated database retrieval system