KEGG   Bacillus subtilis subsp. subtilis 168: BSU08320
Entry
BSU08320          CDS       T00010                                 

Symbol
yfiM
Name
(RefSeq) transport permease YfiM
  KO
K25143  linearmycin/streptolysin S transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08320 (yfiM)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Linearmycin/streptolysin S transporer
    BSU08320 (yfiM)
SSDB
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC2_membrane_2 ABC2_membrane_4 ABC2_membrane_5
Other DBs
NCBI-GeneID: 939210
NCBI-ProteinID: NP_388713
Pasteur: BG12218
BSORF: BG12218
UniProt: P94441 A0A6M4JG38
Position
906764..907954
AA seq 396 aa
MKKSIWIAWKDVKIRITDRKGFMMLILMPLILTCILGAALGSVVDGGSRIDDIKVGYIQS
DQSDTANMFTKDVLKKMKSIKVTKVGSKDKMKKLIDEKKIDVGIVIPNHWEAGKTSAVVN
AAPDQTLKSSIIETAASSFIEQYKAVKEAASGSMDYISKTEAVKQGKLDPAQFAEKLAKT
LEKETGDKLTIAEKSVGSKAVTSFQYYSAAMLCMFMLFHITVGAKSFLQEKDTETLARML
MTPAQKSVILFGKWLGTYLFAIIQFFIFLIVTINVFGVDWGGNLLLVSVLGLSYAAAVSG
ISMLLASCISDMKTADAIGGFGIQLLAVLGGSMLPLYQFPDVLQSVSKAVPNRWALDGFL
SLMEGGGWADLQKPVLLFAAIGFCSLVIGIRRLHTR
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgaaaaaaagcatatggatcgcatggaaagatgtgaaaatcagaatcacggacagaaaa
gggtttatgatgcttatcctaatgccgctcatcctaacctgtattttaggcgcagcgctc
ggatcagttgttgacggaggcagccggattgatgatatcaaagtcggctacattcaatca
gaccagtcagatacagcaaacatgtttacaaaagatgttctcaaaaaaatgaagtcgata
aaggtcacaaaagtcggcagcaaagacaagatgaaaaaactgattgatgaaaagaaaatc
gatgtaggcatcgttatcccgaaccattgggaagccggcaaaacctcagctgttgttaat
gccgctcctgatcaaacattgaaaagttccatcattgaaacagctgcaagctcatttata
gagcaatataaagcggtaaaggaagccgcgtcaggctcaatggactacatcagtaaaacg
gaagctgtaaagcaaggaaaacttgaccctgcacagtttgcagaaaagctggcaaagacg
ctagaaaaagaaacaggtgacaagcttactattgcggaaaaatctgtcggcagcaaagcc
gttaccagttttcaatactattcggcggcaatgctttgcatgtttatgctgtttcatatc
acagtcggggcgaaatcatttttacaggaaaaggatacggagacgcttgccagaatgctg
atgacgcctgcgcaaaaatccgtcattctcttcggaaaatggcttgggacgtatctgttt
gccatcatacaatttttcatatttctgatcgtcacaatcaacgtatttggtgtggactgg
ggcggtaatctgctgttagtgagtgtactcgggctttcttacgccgcagctgtatctggt
atttcaatgctgcttgcgtcgtgcatcagcgatatgaaaactgcagatgcgataggcggc
ttcggcattcaattgcttgcggttctcggcgggtccatgctgccgctgtaccaatttccg
gacgtcttgcagtctgtatccaaagcggtgccaaatcgctgggcgcttgacggctttctt
tctttaatggaagggggaggctgggctgaccttcaaaagcctgtgcttctttttgcggcg
atcggcttttgttcacttgtaattggtatcagacggcttcatacaagataa

DBGET integrated database retrieval system