KEGG   Bacillus subtilis subsp. subtilis 168: BSU08330
Entry
BSU08330          CDS       T00010                                 

Symbol
yfiN
Name
(RefSeq) transport permease YfiN
  KO
K25142  linearmycin/streptolysin S transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08330 (yfiN)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Linearmycin/streptolysin S transporer
    BSU08330 (yfiN)
SSDB
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC2_membrane_2 HTH_19
Other DBs
NCBI-GeneID: 939705
NCBI-ProteinID: NP_388714
Pasteur: BG12219
BSORF: BG12219
UniProt: P94442 A0A6M4JGN1
Position
907968..909125
AA seq 385 aa
MKKILAICGIELSLIFKKPQNYLIMFAAPLLLTFVFGSMLSGNDDKVRLAIVDQDDTILS
QHYIRQLKAHDDMYVFENMSESKASEKLKQKKIAGIIVISRSFQTQLEKGKHPELIFRHG
PELSEAPMVKQYAESALATLNIQVTAAKTASQTAGENWKAAYKTVFAKKHEDIVPAVTRQ
TLSDKKEGAEASDTASRAAGFSILFVMLTMMGAAGTILEARKNGVWSRLLTASVSRAEIG
AGYVLSFFVIGWIQFGILLLSTHWLFGINWGNPAAVIVLVSLFLLTVVGIGLMIAANVRT
PEQQLAFGNLFVIATCMVSGMYWPIDIEPKFMQSIAEFLPQKWAMSGLTEIIANGARVTD
ILGICGILLAFAAITFAAGLKALRA
NT seq 1158 nt   +upstreamnt  +downstreamnt
gtgaaaaaaattctagccatttgcggcattgagctttctctcatttttaagaagccacag
aactatttgatcatgtttgctgccccgcttttgcttacctttgtatttgggagtatgctc
agcggcaatgatgataaggtgcggcttgcaatcgttgatcaggacgatacgattctctca
cagcattatattcggcagctgaaggcacacgatgatatgtatgtattcgaaaacatgtct
gaaagcaaagcgtcagaaaagctgaaacaaaagaaaattgccgggatcatcgtcatttcc
cgctcgttccagacacagctggaaaaaggcaaacatcctgagctgattttccgtcacggc
cctgagctgtcggaagcgccgatggtcaaacaatatgcagaaagcgcattggcaacgctc
aatattcaggtgaccgcggcaaaaacggcatctcagacagcgggagagaactggaaggcg
gcgtataaaacggttttcgccaaaaaacatgaagatatagttccggctgtaacacgacag
acgctcagtgataaaaaagagggtgcggaagcaagtgacacagcctccagagcagcaggg
ttttccatcctgtttgtcatgctgaccatgatgggagcggctggaaccattttagaagca
agaaaaaacggcgtatggtccagattgcttacagcctctgtcagccgagccgaaatcggt
gctgggtatgtgctgtccttctttgtcattggctggattcaatttggaatattgcttctt
tccacccattggctgtttggcatcaactgggggaatccggctgcagttattgtattagtg
tcactttttctattgaccgttgtcggcattggattgatgattgcggccaacgtcagaacg
ccagaacagcagcttgcgttcggcaacttgtttgtcatcgcaacatgtatggtgagcggg
atgtattggccgatcgacattgaaccgaaatttatgcaatccatcgctgaatttcttccg
caaaagtgggcgatgagcgggttgacagagattatcgctaacggtgcccgcgtcacagat
attctcggaatctgcggcattttgcttgcatttgctgcgatcactttcgcagcggggctg
aaagcgctccgagcctaa

DBGET integrated database retrieval system